KEGG   Acyrthosiphon pisum (pea aphid): 100162318Help
Entry
100162318         CDS       T01076                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00010  Glycolysis / Gluconeogenesis
api00562  Inositol phosphate metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100162318
   00562 Inositol phosphate metabolism
    100162318
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100162318
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100162318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100162318
NCBI-ProteinID: XP_001943809
APHIDBASE: ACYPI003477
UniProt: J9JT24
Position
Un
AA seq 472 aa AA seqDB search
MLVTGRVLAVSLLFSAMAASTAALTDWQHASSSLRQQMDYGRMCYRTVQNPYMYFGTKTT
YGAVAGNDLQTPPDCRPMQVWLVSRHGTRYPSRKKIEELKKLNELKTMITAESTMCPEDI
VAIKNWNTNLTKDDHYMLQRQGVEELKSLAVRLKRQFPQIFNNPYTEANFKFLTSHKQRA
KDSATVFYQSVFNQNPENELPIVKTSDDRFYLYKCKQVEDDDDTKGLGEVKKFEDGPLVR
SVVSRVSMAMGLKQNLSYENVSLMLESCMYEKAWYIQSRPAWCAVFTQNDFEILEYVDDL
KHYYGNGYGNPIGESMGCPIVKDLIDNFKNISRGKQGPLGIFYFGHSLNVLSVVARLGIG
KDNTPLLSTNFEQMKTRKWRTSFIDPFASNVIAVFYKCMDGNKAMILLNEHGIPMGKDEC
RTCPWEPIEAQFNAITSNNQTCNLNMCKNCAALSSFNLVIVIFAYVIHLLYI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcacgggacgtgtgttagcggtatcgctgctgttctcggcgatggccgcgtcc
acggccgcgcttactgactggcagcacgcctcgtcgtcgctcaggcaacagatggactac
ggccgcatgtgctaccggaccgtccaaaatccgtacatgtacttcggcacaaagaccact
tacggtgcggtggccggcaacgacttgcagactccgccagattgccgaccgatgcaagta
tggctggtatccaggcatggtacgcggtatccatcgcgaaaaaagatcgaggaacttaag
aagttgaacgaacttaagacaatgataacggctgaatcgacaatgtgccctgaagatatc
gtggccatcaagaactggaatacaaatctgactaaagacgaccattatatgctgcagagg
cagggtgtcgaggaacttaagtcactggccgttcggctcaaaagacaattcccacagata
ttcaataacccatacaccgaagccaacttcaaatttctgacttcgcataaacaacgtgcc
aaagacagcgccaccgtgttttaccaatcggtgttcaaccaaaatcccgaaaatgaatta
ccgatcgtcaaaacttcggatgatagattttatctgtacaagtgcaagcaggtcgaagac
gacgacgacacaaagggactaggagaagtgaaaaagttcgaggacggcccactcgtgcgg
tccgttgtgtccagggtatctatggcgatgggccttaaacaaaacctcagttacgaaaat
gtttcactgatgttagaatcgtgcatgtatgagaaagcttggtacatacagtcgcgacca
gcatggtgtgccgtgttcacgcaaaacgatttcgaaatccttgaatacgtagatgatctc
aaacattactatggcaatgggtatggaaatcccattggagagagcatgggatgccctatt
gtgaaggacttgatagacaatttcaagaacatttcaagagggaaacaaggaccattagga
atattttactttggacactcgcttaacgttttgagcgtggttgccaggttgggcatcgga
aaagataatactccattactgagtacaaactttgaacagatgaaaactagaaaatggagg
acatcattcatagatccatttgcgtcaaatgtaatagcagtgttttacaaatgtatggat
ggaaataaagccatgattttactcaacgaacatggcataccgatgggtaaagatgagtgc
cgaacctgtccatgggaaccaattgaagcacaatttaatgcaataacctctaataaccaa
acatgcaacttaaatatgtgtaagaactgtgcagcattatcctcattcaatttagtcata
gtcatatttgcatacgtaatacacttactgtatatttag

DBGET integrated database retrieval system