KEGG   Acyrthosiphon pisum (pea aphid): 100163358Help
Entry
100163358         CDS       T01076                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00190  Oxidative phosphorylation
api01100  Metabolic pathways
Module
api_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100163358
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     100163358
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     100163358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 100163358
NCBI-ProteinID: NP_001280280
APHIDBASE: ACYPI004451
UniProt: C4WRX0
AA seq 255 aa AA seqDB search
MSIRIITRAIQRLSTVRTGTRTPTYFKLMTRAESTTVVPKQKFDSVTEQYLGFGNFVAEC
LPKYIQKIQISSKNELELLIAPEGVLPVFHFLKNQTNCQFANLSDLCAVDVPQRSNRFEI
VYNLLSLRFNTRIRVKTYTDELTPIDSITSIYEAANWYEREIWDMFGVFFTNHPDLRRIL
TDYGFEGHPFRKDFPLSGYVEVRYDDEKKRVVVEPLEMSQEFRRFELSTPWEQFPNFRSA
SPTTEEVVSADKEKK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataaggatcataaccagagcgattcaaagattaagtacagttcggactggtacc
aggacgcctacgtattttaagctgatgacccgagctgaatccactacagtggtaccaaaa
caaaaatttgattcagtaacagaacaatatcttggatttggaaattttgttgctgaatgt
ttacctaagtatattcaaaaaattcaaataagttctaaaaatgaattagaattactgata
gcaccagaaggtgtcttaccagtatttcattttttaaaaaatcaaacaaattgccagttt
gctaacttatcagatttatgtgctgtagacgttcctcaacgttcaaatagatttgagatt
gtttacaatttgttgtctcttcgattcaatactcgcatacgtgtcaagacttatactgat
gagttaacaccaattgattccattacatctatttatgaagcagcaaattggtacgaaaga
gagatttgggacatgtttggagtgtttttcactaatcatccagatttaagaagaattctt
actgattatggatttgaaggtcatccattccgtaaagattttccattgtctggatatgta
gaagtaaggtatgatgatgaaaaaaagagagttgtggtagagccattagaaatgtcccaa
gaattcagacgttttgagctatctactccatgggaacaatttccgaattttagaagtgct
agtcccaccactgaagaagtggtatcagcagacaaagaaaaaaaataa

DBGET integrated database retrieval system