KEGG   Acyrthosiphon pisum (pea aphid): 100163558Help
Entry
100163558         CDS       T01076                                 

Gene name
Cych
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03022  Basal transcription factors
api03420  Nucleotide excision repair
Module
api_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100163558 (Cych)
  Replication and repair
   03420 Nucleotide excision repair
    100163558 (Cych)
Transcription machinery [BR:api03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100163558 (Cych)
DNA repair and recombination proteins [BR:api03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100163558 (Cych)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C TFIIB
Motif
Other DBs
NCBI-GeneID: 100163558
NCBI-ProteinID: NP_001156680
APHIDBASE: ACYPI004637
UniProt: C4WWH4
Position
Un
AA seq 300 aa AA seqDB search
MFPTSTQKTNWIFKDELDLNALREDANQKFITRFGSHMSPEDRNTFFLDANEEHIIQKCH
EYILRDFCHKFQPTMPKYVFATALNYLKRFYLYNSVMDYHPKEIMVTCLFLACKVDEFNV
SLAQFVANIKGNQSRATTVILNNELFLMEQIKYNLKVHHPFKAIEGFLLDIKTRTRMSDP
DRMRTHIDSFIDKLLFTDACLLFAPSQLALAAVLHSASQIKENLDSYVTDLLLGDTGSEH
LKDLIEVVRRIRILHVRIADDHTKELSRISKKLDKCRNQENNPFSEKYKDRIQESLNNSL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaacgagcacgcaaaaaacgaattggatattcaaagacgagttggatttgaat
gcattgcgagaggatgccaaccagaagttcattaccagattcgggtcgcacatgagtccc
gaagaccgaaatacattttttttagatgccaacgaagagcatataatacagaaatgtcac
gagtatatattaagagatttctgtcacaagtttcagccaaccatgccaaagtacgtattc
gcaactgctttaaactatctgaaacgattttacctgtacaattcggtcatggattaccat
cccaaagaaataatggtcacctgtctgtttttggcgtgcaaagttgatgagttcaatgta
tcgctcgcacaatttgtcgccaacattaagggcaaccaatcaagagcaaccacagtgata
ctgaataatgagttgtttcttatggaacagatcaagtacaacctcaaagtgcaccatcca
ttcaaggcaatcgaaggattccttctagacataaagactagaacacgaatgtccgatcca
gaccgtatgcgtactcacattgatagtttcattgacaagctattgtttacagacgcatgt
ttattatttgcaccatctcagctggcactagctgctgtattacattcggctagtcagatc
aaagaaaatttggattcatatgtaaccgacttactgttaggtgatacggggtctgagcat
ttaaaagatttgatagaggttgtacggagaataagaatattgcacgtcagaatagcagat
gatcatacaaaagaactgtcacgtattagcaaaaaattagataaatgtcggaaccaagag
aacaatccattcagtgaaaaatataaagatagaatacaagaatcattaaataattcttta
tag

DBGET integrated database retrieval system