KEGG   Acyrthosiphon pisum (pea aphid): 100164369Help
Entry
100164369         CDS       T01076                                 

Definition
(RefSeq) dual specificity protein phosphatase 10 isoform X2
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04013  MAPK signaling pathway - fly
api04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:api00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    100164369
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100164369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:api01009]
    100164369
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100164369
    3.1.3.48  protein-tyrosine-phosphatase
     100164369
Protein phosphatases and associated proteins [BR:api01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    100164369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese SUIM_assoc Y_phosphatase PTPlike_phytase TFIIA Init_tRNA_PT Spt20
Motif
Other DBs
NCBI-GeneID: 100164369
NCBI-ProteinID: XP_001946638
APHIDBASE: ACYPI005391
UniProt: J9JY81
Position
A2
AA seq 426 aa AA seqDB search
MSAVCYEGGVGGRSRAGLRLSLNRSISEPGPATPPITVTTPTTSKRFRLESIPSLPASLP
ASPNSEGTNLSSALILNKVKRMSSDYFRQKLELFGPAVLAIDCRSFVCYNVSHVRGAVNV
NVADRINRRRLQTGKATLVELASSRDAKDALRRRGYREIVVYDDSTTDLDRVPHNHPLML
ILASLVDDEREPSFLIGGHKEFHSRHKDMCENSLLPAPLIASCPTDVDRESMDTHPLTKV
LPFLYLGNSKDADDRDGMTAIGVTRVLNVTTSQQSPSPTMDHRASGVVYKRLSVLDNGHA
NLKQYFEEAFEFIEGARKSGGSVLIHCQAGISRSPTIAIAYVMRHRKTSMVDAYKMVKAA
RPIISPNLNFMGQLLELEQSLQQYEQQQQQQQQQQQQQQQHQQPRCGQSWVAAQSAADEL
SPGCST
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgtctgttacgagggtggagtcggtggtagatcccgagctgggcttaggctc
agtctgaacaggagtatcagtgagccgggcccagcaacaccaccgattactgttactaca
ccgacaacctcgaaacgttttcgattggaatctatacctagtctacctgctagtttaccc
gctagcccaaattctgagggtacaaatttaagcagtgctctaatactcaacaaggtaaaa
cgaatgagcagtgattattttagacaaaaactggaacttttcggaccagcggtcttggcc
attgactgtcggtctttcgtatgctacaacgtcagccatgtcagaggtgctgtgaacgtg
aacgtcgccgaccggattaacagacgaagattgcaaacgggaaaagccactttggttgag
ttggcgtcttctagggacgccaaagacgctctaaggaggcgtggttacagagaaattgta
gtgtacgatgactcgactacagacttagacagagtgccccataaccatcctctgatgcta
atccttgcatcgttagtggacgatgaaagagaaccatcgtttcttatcggtggccacaag
gagtttcattctcggcataaggacatgtgcgagaactccctgctgccggcgccgctgatc
gccagctgccctacagatgtggaccgcgagtccatggacacccacccactcaccaaggtg
ctcccattcttgtaccttggtaacagcaaagatgccgacgaccgggatggtatgaccgcc
atcggggtgacacgtgtgctgaacgtgaccactagccaacagtcaccgtccccgaccatg
gaccaccgcgcttccggcgtcgtgtacaagcgactctccgtcttggacaacgggcatgcc
aacctcaagcagtacttcgaagaagcgttcgaattcatcgaaggcgctcggaagtccggc
gggagcgtgctgatacactgccaggccggcatatctcggtcgccgaccatagccatcgcg
tacgtgatgcgccaccggaagacgtccatggtggacgcgtacaagatggtcaaggcggct
cggccgatcatatcgccgaaccttaactttatgggccagctgctcgagctcgagcagagc
ttacagcagtacgaacagcagcaacagcaacagcagcaacaacaacaacagcagcagcag
caccagcaaccgcgttgcggacagtcttgggtcgccgcccaatccgccgcagacgaactg
tcgcccgggtgtagtacataa

DBGET integrated database retrieval system