KEGG   Acyrthosiphon pisum (pea aphid): 100164958
Entry
100164958         CDS       T01076                                 

Gene name
Usp
Definition
(RefSeq) ultraspiracle
  KO
K08524  retinoid X receptor alpha
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:api03000]
    100164958 (Usp)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:api03310]
    100164958 (Usp)
Transcription factors [BR:api03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100164958 (Usp)
Nuclear receptors [BR:api03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100164958 (Usp)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100164958
NCBI-ProteinID: NP_001155140
APHIDBASE: ACYPI005934
UniProt: J9JZN9 C5IJJ4
AA seq 433 aa
MFKKEKPMMSVSAIIQSRAAHHHWGRGLRLDNNMSLGSMGPQSPLDLKPDTATLMVNFSP
PGAPLSPAGLYSVDRNNMMNNSCNVQDSPNYPPNHPLSGSKHLCSICGDRASGKHYGVYS
CEGCKGFFKRTVRKNLSYACREENKCIIDKRQRNRCQYCRYQKCLTMGMKREAVQEERQR
TKERDHNSIEVEPTSSSNTDMPVELILRAENKADAIKTEQQYIEQQHPQHTVGAICQATD
KQLIQLVEWAKHIPHFKNLPLGDQVLLLRAGWNELMIAAFSHRSISVKDGIVLATGLTVD
RDSAHQAGVEAIFDRVLTELVAKMRDMGMDRTELGCLRTIILFNPGSKGLQSVNEVEVLR
DKVYVALEEYCRTTHPEEPGRFAKLLLRLPSLRSIGLKCLEHLFFYKLIGDSPIDTFLME
VLESSSHDVQVAT
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgttcaagaaagaaaaacccatgatgtccgtgtcggccatcatacagagcagggcggcg
catcaccactggggcagaggattaagattggacaataatatgtcactgggttcaatgggt
cctcagtcacctctagacctcaaacccgacacggcaactctaatggtcaatttcagccct
ccgggagctcctctaagtcctgcaggattatacagtgtcgaccggaacaatatgatgaat
aattcttgcaacgtacaagactctccgaattacccgcccaaccatccgctcagcggttcg
aaacatctgtgctccatatgcggcgatcgcgccagcggaaaacattacggagtgtacagc
tgcgaggggtgcaaagggttcttcaaacgtaccgtgaggaagaatttgtcttatgcgtgt
cgcgaagaaaacaaatgcatcatcgacaagcgccaacgaaatcggtgccagtactgcagg
tatcaaaaatgtttgaccatgggcatgaaaagagaagccgtgcaggaggaaaggcaacgt
acaaaagaacgagatcataatagcatagaagttgaacccacgagcagttctaatactgat
atgccagtggaacttatattaagggctgagaataaagctgatgctataaagactgaacaa
cagtatatagagcaacaacatcctcaacatactgttggtgctatttgtcaagcaactgac
aagcagttaatacaacttgttgagtgggccaagcatataccgcattttaaaaatttacct
ctaggcgatcaagttttgttattgagagctggttggaatgagttgatgattgcagcattt
tcccatagatcaatcagtgtaaaggatggtatagtcttagctactggacttactgttgac
agagattcagctcaccaagctggtgttgaagctatatttgatcgtgtactcactgaactc
gttgctaaaatgagagatatgggtatggatagaacagagcttggctgtttacgtactatt
attctttttaatccaggttcaaaaggtttgcagtctgtgaatgaagtggaagtactacgt
gataaggtttatgttgcgttagaagaatattgtcgtacaacacatccagaagaacctggg
cgatttgctaaactacttcttcggcttccttcattacgttcaattggtttaaaatgtctg
gaacatttattcttttataaacttattggagattcaccaatcgatacatttttaatggaa
gttcttgaatcatcgtcacatgacgttcaagtagctacatga

DBGET integrated database retrieval system