KEGG   Acyrthosiphon pisum (pea aphid): 100165804Help
Entry
100165804         CDS       T01076                                 

Definition
(RefSeq) triosephosphate isomerase-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00010  Glycolysis / Gluconeogenesis
api00051  Fructose and mannose metabolism
api00562  Inositol phosphate metabolism
api01100  Metabolic pathways
api01200  Carbon metabolism
api01230  Biosynthesis of amino acids
Module
api_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
api_M00002  Glycolysis, core module involving three-carbon compounds
api_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100165804
   00051 Fructose and mannose metabolism
    100165804
   00562 Inositol phosphate metabolism
    100165804
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100165804
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100165804
  Exosomal proteins of bladder cancer cells
   100165804
  Exosomal proteins of melanoma cells
   100165804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100165804
NCBI-ProteinID: NP_001155676
APHIDBASE: ACYPI006727
UniProt: C4WT45
Position
Un
AA seq 247 aa AA seqDB search
MSRKFFVGGNWKMNGTKKVADELLSNLVKGPLDPNVEVLIGVPAIYLDFVKEKAPCNIYV
AAQNCYKTEKGAFTGEISPSMLKDIGIDWVILGHSERRQIFQETDTLIAEKVNHALESGL
SVVACIGETLEEREAGQTEAVVAKQIKAIKEKICNWQNVVIAYEPVWAIGTGKTASPQQA
QDVHKILRKWLSDEVNETVAKTTRIIYGGSVTSSNCRELAKECDIDGFLVGGASLKPEFV
EIVNANQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcaaattctttgttggaggaaactggaagatgaacggtacgaagaaagttgct
gatgaactactcagcaatttagtaaagggacctttggaccctaatgttgaggttttgatt
ggagtaccagccatatacttggattttgtcaaagaaaaagcgccatgtaacatatatgtt
gcagcacagaattgttataaaactgaaaaaggcgcgtttactggagagataagccccagt
atgttaaaagatattggtattgattgggtgattttaggtcactctgaacgtcggcagata
tttcaagaaactgatactctcattgctgaaaaagtaaatcatgctcttgagtctggatta
tctgttgtcgcatgtattggtgaaactcttgaagaacgtgaagctggacaaactgaagcg
gttgtagctaagcaaatcaaagctattaaggagaaaatatgcaattggcaaaatgtagtt
attgcttatgaaccagtctgggccattggtactggtaagactgctagccctcaacaagcc
caagatgtccataaaattttgagaaaatggttgagtgatgaagtaaatgaaactgttgcc
aagactacacgcatcatttatggtggatctgtgacatcatctaattgccgagaattagct
aaagaatgcgacattgatggatttttggttggaggtgcatccttaaaaccagaatttgtt
gaaatagtcaacgctaatcagtaa

DBGET integrated database retrieval system