KEGG   Acyrthosiphon pisum (pea aphid): 100166001Help
Entry
100166001         CDS       T01076                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00790  Folate biosynthesis
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100166001
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     100166001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Terminase_6
Motif
Other DBs
NCBI-GeneID: 100166001
NCBI-ProteinID: XP_001951138
APHIDBASE: ACYPI006909
Position
A3
AA seq 235 aa AA seqDB search
MAAGKILVYGGKGALGSTCISFLTAQKYWVGSIDLTRNEVANANVIVERDATILEQESQI
LKELESVLGSEKLDAVICVAGGWAGGSSSSDDFVKNTDLMLKQSVSSSVLASSIASKYLK
PGGILVLTGAKAALGPTPGMIGYGLAKAAIHHLTKSLADENGGLPTGAQALSILPVTLDT
PMNRKWMPKADTSTWTPLEFVAELFSKWIKNEERPPNGSLVQLNTKENKTTLEFE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgccggcaaaatattggtgtacggaggaaaaggagcgttgggatcgacgtgcata
tcgttccttacggcccaaaaatattgggttggatcaatagacctaactcgaaatgaagtt
gcaaacgctaatgtgatcgtggaacgggatgctacaatattagaacaagaatcacaaatt
ttgaaggagctcgagtccgttttaggatctgaaaaattagatgctgtaatatgtgtagct
ggtggttgggccggcggtagctcaagctctgatgattttgtaaaaaatactgatttgatg
ttaaaacaaagtgtttcgagctcagtattagcatcatccattgcgtccaaatatttaaaa
cctggaggtattttagtattgactggtgctaaagctgctcttggtcccacaccaggaatg
attggttatggtttagctaaagcagcaatacatcatttgacaaaatcattggctgatgaa
aatggtggtttacctacaggagctcaagctctttcaatattgcctgtcacactcgacaca
cccatgaatcgtaaatggatgcctaaagctgatacttcaacttggactccattagaattt
gttgcagaattgttttccaaatggattaaaaatgaagaaagacctccaaatggttcactt
gttcagttaaatacaaaggaaaataaaacaactttggaatttgaataa

DBGET integrated database retrieval system