KEGG   Acyrthosiphon pisum (pea aphid): 100166032
Entry
100166032         CDS       T01076                                 
Symbol
Uckl1
Name
(RefSeq) uridine-cytidine kinase 1-like 1 isoform 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00240  Pyrimidine metabolism
api00983  Drug metabolism - other enzymes
api01100  Metabolic pathways
api01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100166032 (Uckl1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100166032 (Uckl1)
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     100166032 (Uckl1)
SSDB
Motif
Pfam: UPRTase PRK AAA_18 CPT AAA_33 Cytidylate_kin AAA_17 CoaE Zeta_toxin
Other DBs
NCBI-GeneID: 100166032
NCBI-ProteinID: NP_001153854
Position
A1:150358237..150367023
AA seq 558 aa
MAAKIQPFDPPSSASSDSDLNEYRDVVGDISIALDNDDEESDSIISSSMSPSKQSNSAPS
TVLVKSPRSTLRQRTTSVSQSTKKTASESVLQSHTRTIYTAGRPPWYNTAGQQVEPFVIG
VCGGSASGKTTVARKIIESLNVPWVVLLSMDSFYKVLTAEQHEKAAHNEYNFDHPEAFDF
ELLTSTLQRLKDGKKVEVPIYNFVTHARETKTKTMYGANVIIFEGIMAFYNSDVLKILDM
KVFVDTDADIRLARRLKRDISQRGRDLQGVLKQYCNMVKPSFSHYIAPSMIHADIIVPRG
GDNTVAIELIVRHVHKQLQARGFKLRETLAMSYVGQPLPSSIHLLPSTPQTQGLHTFIRN
KDTPKDEFIFYSKRLIRLVIEFALSLLPFKDVIVDTPQCVPYSGKRCASDKICGVSILRA
GETMEQAVCDVCKDIRIGKILIQTNRSTGEPELYYLRLPKDIKDYMVILMDATVATGAAA
MMAIRVLLDHDVPEENILLVSLLMAESGVHTIAYAFPQVRIVTSAVDPEINEKFHVLPGI
GNFGDRYFGTEPEEYTSS
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctgctaaaatacaaccgttcgatcctccaagttctgccagttccgatagtgatttg
aacgaatatcgagatgtagttggtgacatttcgatagctttagataatgatgacgaagaa
agtgatagcataatctcatctagtatgtcaccatctaaacagtcgaatagtgcgccatca
accgtgttggtgaaatctcctcggtcaactctgcggcaaagaacaacttctgttagccaa
tcgactaagaaaacagcttcagagtcagtattacagtctcacacgcgcacaatttataca
gctggtcgaccaccatggtacaacactgctggacaacaagtagaaccatttgttattggt
gtatgtggtggaagtgcttctgggaaaacaactgtggctagaaaaataatagaatcgtta
aatgtaccatgggttgttctgcttagcatggattcattttataaggtgctaactgcagaa
caacatgagaaagctgcccataatgagtataactttgatcatccagaagcgtttgatttt
gaactcttaacttctactttgcaaaggttgaaggatggcaagaaagttgaagttcccatt
tataattttgtcacacatgctagagaaactaaaactaaaacaatgtatggtgcaaatgtc
ataatatttgaaggaattatggcattttataattcagacgttttgaagattttggatatg
aaggtatttgtagatactgatgctgatatcagattagcacggagactcaagagagatata
tctcaacgaggtagagatcttcaaggtgttttaaaacagtattgtaatatggtaaaacca
tcattttcacattatatcgctccgtccatgatccatgccgatataattgtacctcgaggt
ggagataatacagtagctatagaattgattgttcggcatgtacataaacaactacaagcg
cgagggtttaaattacgagaaacacttgcaatgtcttatgtcggtcaacctctacccagt
tctattcatctattgccatctacaccacaaacacaaggcttacatacgttcatacgaaac
aaggacacacccaaggatgaatttatattttattccaaacggcttattagactagtcatt
gagtttgcactatcattgttgccattcaaagacgttattgtagatactccacagtgtgtt
ccatattctggtaagagatgtgctagtgacaagatatgtggtgtgtcgattttgagggct
ggagaaacaatggaacaagcagtttgtgacgtttgtaaggacatacgtatcggaaaaatt
ttgattcaaacaaatagatctactggggaaccagaactttattatttgcgcctacctaaa
gatattaaagactatatggtaattttaatggatgccacagtagctaccggtgcagctgca
atgatggccattcgagtacttttagatcacgatgttcctgaagaaaatattttattggta
tcattactaatggctgaatctggggtgcacacaattgcatatgcatttcctcaagtgcgc
atcgtcacatcagctgtcgatccagaaataaatgaaaaattccatgttttaccaggaatt
ggcaactttggtgatagatattttggcactgaaccggaagagtacacatctagttag

DBGET integrated database retrieval system