KEGG   Acyrthosiphon pisum (pea aphid): 100166092Help
Entry
100166092         CDS       T01076                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:api01001]
    100166092
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100166092
Protein kinases [BR:api01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   100166092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 100166092
NCBI-ProteinID: XP_008178646
APHIDBASE: ACYPI006993
UniProt: J9K2K0
Position
X
AA seq 359 aa AA seqDB search
MLNSTVMEGNDFYFLNNKTKTTPVEKDYRISNNVLGLGINGKVVQCFSVKTGEKFALKVL
VDCQKARREIDLHWRASGCINIVNIIDVYENQYMDKKCLLVIMECMEGGELFQRIQEHND
GAFTEREAAHIMTAICSAVKYLHDLNIAHRDLKPENLLYSKLGANGILKLTDFGFAKEVS
QKAPLKTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGFPPFFSNHGQAISPGM
KNRIKTGQFDFPSPEWNNVSSDAKTLISSMLSVDPSVRLTINEVVKHNWIASYTEVPQTP
LYTGKMLKESEDVWPEVQEEMTRSLATMRVDYDQVNIKSLNTSNNPLLNKRRKKASNST
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttaaactcgacggttatggaaggaaacgatttctattttctcaacaataaaaccaag
actacacctgtcgaaaaggattacagaatatccaataacgtactcggactgggtatcaat
ggcaaagtggtgcagtgtttttccgttaaaaccggtgaaaagtttgcgcttaaggttctc
gtggactgtcagaaagctaggagggaaatcgatctacactggagggctagcggttgcata
aatatagtcaatataattgatgtatacgaaaaccagtacatggataaaaaatgtttgctg
gttatcatggaatgcatggaaggtggtgaattatttcaacgtatacaagagcacaatgat
ggggcctttaccgaaagagaagctgcacatattatgacggctatttgttcagcagtcaag
tatcttcatgaccttaatattgctcaccgtgacttaaagcctgaaaatcttttgtattct
aagcttggtgctaatggtattttaaaattaactgattttggatttgccaaggaagtttca
caaaaagctccattaaaaactccatgctatacaccatattatgttgcaccggaagttcta
ggtccagaaaagtatgataaaagttgtgatatatggtcattaggtgttatcatgtatata
ttattatgtggatttccacctttttttagtaatcacgggcaagctatttcacctggcatg
aaaaatcgaattaaaactggacagtttgactttcctagtcctgaatggaataatgtatct
agtgatgctaaaactttaatttcaagtatgttatctgttgatccttcagttcgtcttacc
atcaatgaagttgtaaaacataattggattgcaagctataccgaagtaccacaaacaccg
ttatatactgggaaaatgttgaaagagtccgaagatgtgtggcccgaagtacaagaagaa
atgacccggtctctagctacaatgcgtgtggattacgatcaagtcaatataaaatcatta
aatacttctaacaatccattattaaacaaacgacggaaaaaagcttcaaacagtacttag

DBGET integrated database retrieval system