KEGG   Acyrthosiphon pisum (pea aphid): 100166541
Entry
100166541         CDS       T01076                                 
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 13 isoform X5
  KO
K04422  mitogen-activated protein kinase kinase kinase 13 [EC:2.7.11.25]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:api01001]
    100166541
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100166541
Protein kinases [BR:api01001]
 Serine/threonine kinases: TKL group
  MLK family
   100166541
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ABC1
Other DBs
NCBI-GeneID: 100166541
NCBI-ProteinID: XP_001944586
APHIDBASE: ACYPI007402
Position
A1:complement(160330322..160353185)
AA seq 707 aa
MRYSLSDMFVKTMPSLKLSDKNMLCIQEELGNLKDKEPVKDNAVENNKLESDVLKSSGWF
DGWLGCLKPMLGGIMGKGNSHDLKSYQDNWDIPFESISDLQWLGSGAQGAVFSGKLKNEI
VAVKKVREQKETDIRHLRKLNHPNIVQFKGVCTQAPCYCIVMEYCPYGPLYNLLRDGEEI
PPMRLVSWAKQIASGMYYLHVNKIIHRDLKSPNVLIGRQEMVKISDFGTSREWNEISTKM
SFAGTVAWMAPEIIRNEPCSEKVDIWSFGVVLWELMTCETPYKDVDSSAIIWGVGSNSLH
LPIPSSCPDGFRLLIKQCWAAKPRNRPSFKHIMMHLDIASSQVLASTPDEYFKTQAQWKK
EIQIHMLQMQTNGSHIPKFEEDLIKKRKNELKHAQDIREHYERKLERANNLYMELSAVLL
QLEQRENDLIRREKQMSKVYKKRLIRPLLKAQDKLNKLNKSDSTTTSPSSPERLCQQFDS
QLTKATLYAQVSSNSNKPESIAVTPKPNLRKTRPRKAQIICSIVKNKKYDTSKETNWKNN
HQINSNKVNSETQTETIDSGLQQDMLNGNMSDSAHSQGEDSSCSSGVRLSDDEHLDRLGR
QVNEIINNNRPSNMTDLSDYYQDTEPISSNFSLRRKSAGRRPIGPGLRVRRYRMTQYCQE
PNGNSFSLSSSAEKHDFLEAESSTSDSDMKDIDLDSSFYKVSNQFPV
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgaggtacagtttgagcgacatgttcgtcaagaccatgccgagtttgaaactcagtgac
aaaaatatgttgtgcattcaagaagaactcggaaacctaaaagacaaggaaccagtcaaa
gataatgctgttgagaacaataaattggaatctgatgtcttaaaatccagtggctggttt
gatggatggttaggatgcttaaaaccaatgttggggggaatcatgggaaaagggaacagt
catgatcttaagtcttatcaagataactgggatattccatttgaatcaattagtgattta
caatggttaggttcaggagcccaaggtgctgtattcagtggaaaattaaaaaatgaaatt
gtagcagtgaaaaaggtgcgcgagcaaaaagaaactgacatcagacatttgagaaaactg
aatcatcccaacatagtacaattcaagggtgtatgcactcaagctccttgttactgcata
gtgatggaatattgtccatatggaccactttataatttgcttagagatggtgaagaaata
ccacccatgcgattagtatcctgggccaaacaaattgcatctggcatgtattatctacat
gtgaacaaaataattcatagagatcttaaaagtcccaacgtcttgattggtcgtcaagaa
atggtgaaaatcagtgattttggaacaagccgagaatggaatgagataagcactaaaatg
agttttgctggaactgtagcttggatggctcctgaaatcattagaaatgaaccctgttca
gaaaaagtggatatttggtcatttggtgtggttttatgggaacttatgacttgtgaaaca
ccatacaaagatgtagactcatcagctattatatggggtgtagggagtaattctttacat
ttaccaataccttcatcgtgtccagatggttttagactgttaattaaacaatgttgggca
gctaaaccacgtaataggccatcttttaaacacataatgatgcatctagacattgccagt
tcccaagtgctagccagtacaccagatgaatactttaaaacacaggctcaatggaagaaa
gaaatacaaatacacatgctacaaatgcagactaatggaagtcatattcccaaatttgaa
gaagatcttattaaaaaaagaaaaaatgagttaaaacacgcacaagacattagggagcat
tatgagagaaaattggaacgtgccaataatctttacatggaactaagtgctgtgttatta
caattagaacaacgagaaaacgatttaattagaagagaaaaacaaatgtctaaagtgtac
aaaaaacgacttataagacctttattaaaagctcaagataaattgaacaaactgaataaa
tctgattcaaccactacatcaccatcatcaccagaaagactttgtcaacaatttgactct
cagttaaccaaagctacactttatgctcaagtcagtagcaattcaaataaaccagaatca
attgctgttacaccaaaaccaaatctacggaaaacaagacctagaaaagctcaaatcata
tgctcaattgtaaaaaataaaaagtacgatacatcaaaagaaactaactggaagaacaat
caccaaataaatagcaataaagtcaacagtgaaacccagaccgaaactattgattcagga
cttcaacaagacatgctcaatggtaacatgtctgattctgctcattcacaaggtgaggat
agttcttgtagcagtggtgtgagactgagtgacgatgaacatttagatagactgggcaga
caagtaaatgaaataattaacaataacagaccttccaacatgactgatttatcagattat
tatcaggatactgaacctatttctagtaacttcagtcttagaagaaaaagtgctggtcgg
cgtccaattggaccgggtttacgagtacgtcgatacagaatgacacaatattgtcaagag
ccaaatgggaattctttctcattaagttcttcagcagaaaaacatgatttcttagaggcc
gaaagttcaacatcagactctgacatgaaagacattgatctagattcgagtttttataaa
gtatctaatcagtttccagtttaa

DBGET integrated database retrieval system