KEGG   Acyrthosiphon pisum (pea aphid): 100167336
Entry
100167336         CDS       T01076                                 

Definition
(RefSeq) synaptic vesicle glycoprotein 2B isoform X1
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:api00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100167336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:api02000]
    100167336
Transporters [BR:api02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    100167336
SSDB
Motif
Pfam: Sugar_tr MFS_1 MFS_1_like
Other DBs
NCBI-GeneID: 100167336
NCBI-ProteinID: XP_001948090
APHIDBASE: ACYPI008139
UniProt: J9K5L1
Position
A1
AA seq 554 aa
MVVDHSGSNSPDTKFNNGRVKNQETIDLKIKSGTLDRYEKKLDAVENGSFPPTKEVADFE
QAIELTGYGKFHYLLLVVCGFVSTSEEMDVICMSFILPSAQCDLKLNTSSKGWLNSIIFI
GMMAGAYIWGSLADALGRRKVLIVISFMNALCIVASTFAQSYGVFMFFRFLNGAALGGSG
PVIWSYFAEFQPKNKRGSMLSSMAAFWTLGNLFVASLAWIIIPQDIGYRSPTFLYNSWRI
FLAICSIPSVLVAVFLFFLPESPKFLLTRNDHKKALEVFKQIYATNTGNDPEMYPVKSLV
TKSNAIEHDTKKTTSFKSMTEEVAHNTKMIFMPPILKYTWISIVINLSFHIGYYGLMMWF
PELFNRFDEYARAHNGSEQALVCEVTEFVVKTGSHSHVDLCSDKIESGVFLESFITVAAA
IPSNIFAVLGMDTLGRKFFLVFSTMASGICAVGLSLITSKRQNLIVSAIFSSAISCGNAA
LDCLITEIFPTNLRATGMAISMVAARLGGIIGNIVIAALLDLYCPLPTYIVAVLLIGGGL
LCLLLPNTTREPLT
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtggtagatcatagtggatctaacagtccagacacgaaattcaataatggcagggta
aaaaaccaagaaactatcgatctcaaaatcaaaagcgggacgttagacagatacgaaaaa
aaattagacgccgtcgaaaatggttcgtttccccccaccaaggaggtggcagatttcgaa
caagctattgaactcactggttatggaaaattccattatttactgttggtcgtgtgtggt
ttcgtcagcaccagtgaggaaatggatgttatatgcatgtcattcatattaccatcagcc
caatgtgatcttaagctaaatacgtcttccaaaggatggctaaattcaattatattcatt
ggtatgatggctggtgcatacatttggggttcgttagctgatgcattgggtcgtcgtaaa
gtattaattgttatcagttttatgaacgccctgtgtattgttgcatccacttttgcacag
tcttacggtgtattcatgttctttagatttttaaacggagctgcattgggtggtagtggc
ccagtaatatggtcatactttgccgaattccagcccaagaacaaacgtggttcaatgttg
agttcaatggcagcattttggacactcggaaatttgtttgtagcatcattggcatggatc
atcataccacaagatattggctacaggtctcctacgttcttatataattcttggagaata
tttttggccatatgctccattcctagcgtacttgttgctgtgttcctgttttttttacca
gaaagtccgaagtttctattgacccgtaacgatcacaaaaaagcattagaagtattcaag
caaatatatgctaccaatacaggaaatgatccagaaatgtacccagttaaatcactggta
accaagtctaatgcgattgaacatgacactaaaaaaactacttcttttaaaagtatgact
gaagaagtggctcataatactaagatgatatttatgccgccaatattgaaatatacgtgg
atatctatagtgatcaacctcagttttcatattggttattatggtctcatgatgtggttc
ccagagctatttaatagatttgacgaatatgctcgagcccataatggtagtgaacaagca
ctcgtttgtgaagtgactgaatttgtagttaaaacaggatcacactctcatgtggactta
tgttcagacaaaatcgaaagcggtgttttcctcgaatcatttattacagtagcagctgcc
attcctagcaatatatttgccgtgttgggaatggacacattgggcagaaaattcttttta
gtattcagtacaatggcatctggaatatgtgctgttggcttgtcacttatcactagtaaa
agacaaaatttaatagtatctgctatttttagtagtgctattagttgcggtaatgctgct
ttggattgtttaatcacagaaatttttcctacaaatttaagagctactggaatggccata
tctatggtagctgccagactgggaggtattattggaaatattgttatcgctgcgctgcta
gatctctattgtccattacctacttacattgtagctgtgctcctgataggtggagggctt
ttgtgcctattgttgcctaacaccacaagagaaccattaacgtga

DBGET integrated database retrieval system