KEGG   Acyrthosiphon pisum (pea aphid): 100167545
Entry
100167545         CDS       T01076                                 
Name
(RefSeq) STE20-related kinase adapter protein alpha
  KO
K08271  STE20-related kinase adapter protein alpha
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100167545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:api01001]
    100167545
Protein kinases [BR:api01001]
 Serine/threonine kinases: STE group
  STE20 family
   100167545
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 100167545
NCBI-ProteinID: XP_001951624
APHIDBASE: ACYPI008337
UniProt: J9K647
Position
A2:81447929..81450444
AA seq 369 aa
MNFEPDLKQYTMCSVLGSCFSDRAVVFLGKHNKSGNLVAMKNFNLDSMSKTDCQLIQDEI
YNTRQLMHPNLIPYVTSFLDKSQLYVVFPLMGYGSCRDLLRNHFVEGLPETVIAFVLKDV
LQGLEYIHNKGLVHRAIKAGHILIRADGHASLSGLRSMCPIDKRSNLHSLPLQSANNLNW
SSPEMLEQNLLGYNEKSDIYSIGITSCELANGFVPFAETDTTFMLTQKVKGLIPHLLDCT
TCYPYEDNAADNGYQSEETIGVNATPVSNVYTRMFTEEFHNLVELCCQRDPESRPSASNL
LAHTFTKQVKRVNVKVTDLLRPAVPLLKTNVAEISDDLASIGGMSQQLSDLDLLTYAWDF
DLNDIVPTL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaacttcgaaccggacttgaagcagtacaccatgtgctcggtgttgggctcctgtttc
tcggatcgggcagttgtgttcctgggaaagcacaacaagagcggcaacctggtggcaatg
aagaacttcaatttggacagcatgtcgaaaactgactgccagctcatacaggacgagatc
tacaacactaggcaactaatgcacccgaacctcataccgtatgtgacttcctttttggac
aaaagtcagctgtatgttgtgtttccgctcatggggtatggttcgtgcagagacttgttg
cgcaaccatttcgtggaaggattgccggaaacagttatagcatttgtgctcaaggacgtt
ctgcagggacttgagtacatacacaataaagggctcgtacatagggctataaaggcaggt
catatattgatacgcgcggatggacatgcaagtttatcgggcttgcgtagcatgtgtcca
attgataaacgatcaaatttacattccttgccactgcaatcagctaacaacttgaattgg
tctagtccagagatgctcgaacaaaatttgcttgggtacaacgaaaagtctgacatttac
agtataggcataacatcatgtgaactggcaaatggtttcgttccttttgctgaaacagat
accacgtttatgctaacgcaaaaagttaaaggtctaattccacacttgttagactgcact
acatgctatccatatgaagataatgcagctgataatggataccaatccgaagaaacaatt
ggggtgaatgcaacacctgtgagcaatgtttatacaaggatgtttacggaggagtttcac
aatcttgttgaattgtgctgtcaacgagatccagaaagtagaccttctgcgtccaatttg
ttggctcatacttttactaaacaagtgaaacgagtgaatgtaaaagtaactgatttgtta
cgaccggctgtaccactgttgaagacaaatgtagcagaaataagtgatgatcttgcttct
attggaggcatgtcacaacaattaagtgatcttgacctgttgacatatgcatgggatttt
gaccttaatgacatagtaccaacactataa

DBGET integrated database retrieval system