KEGG   Acyrthosiphon pisum (pea aphid): 100167850
Entry
100167850         CDS       T01076                                 

Name
(RefSeq) U1 small nuclear ribonucleoprotein 70 kDa
  KO
K11093  U1 small nuclear ribonucleoprotein 70kDa
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100167850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:api03041]
    100167850
Spliceosome [BR:api03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    100167850
 Complex B
    100167850
SSDB
Motif
Pfam: U1snRNP70_N RRM_1
Other DBs
NCBI-GeneID: 100167850
NCBI-ProteinID: XP_001952270
APHIDBASE: ACYPI008607
UniProt: J9K6T6
Position
A1:68103111..68109777
AA seq 414 aa
MTQFLPPNLLALFAPRDPVPYLPPVAKLPHEKKTRGYLGVGSFMDLFEDPEDTPPPTKIE
TREERLERRRREKAEQVAYKLEQEIALWEPHSVANATTDPFKTLFVARINYDTSESKLRR
EFELYGPIKKIVVTHNKIDGKPRGYAFIEYEYERDMHSAYKHADGKKIDGRRVLVDVERA
RTVKGWLPRRLGGGLGGTRRGGPEVNLKHSGREDNERERERYAREMAGSRSGRSVTTERD
RERDYRDRDRDREREPRRPRSRDRERKRHRSKSRSRERKRRRSRDRGARDVEYDEVEEVP
VTKSRDKDHERERKRKRSRSRDRERKKDRKERDHHRRDKSKDRRDKHDKDNSERDDKIHI
KQEPVDEYDNNYDNYNNEYDGYNSPHDDYDPDMVKKEEPDEENANGSRYSNNVI
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgactcaatttctgccgcccaatttgctggcgcttttcgcgccgagagacccagtccct
tacctgccgccggtcgccaaacttccgcacgaaaagaagacccgtgggtacttgggcgtt
gggagttttatggatttgttcgaagaccctgaagacacgcctcctcctacaaaaattgaa
acccgagaagaacgactagagcgccgtcgacgcgagaaggctgaacaggtggcatacaag
ttagaacaagaaatcgctctatgggaaccacattcagttgcgaacgctacaacagatcca
tttaaaacactatttgttgccagaattaattatgatacatccgaatcaaaattacgaaga
gagtttgaactttatggtcctataaaaaagattgttgtcacacataataagattgatggt
aaaccaagagggtatgctttcattgagtacgaatatgaacgtgatatgcattctgcatat
aaacatgctgatggaaaaaagattgatggacgcagagtgttggtggatgttgagagagca
cggacagtcaaaggatggcttcctagaagattgggaggtggattagggggtacaagacga
ggtggaccagaagtcaacttgaaacattcaggtagggaagataacgaacgggaaagagaa
aggtatgctcgtgaaatggctggtagtcgttccggacgtagtgttactacagaaagagat
cgagaacgtgattatcgtgaccgagatagagatcgtgaacgtgaaccaagacgtcctcgt
agtagagatcgtgaaagaaaacgtcatcgttctaagtcacgttcacgcgaacgcaagaga
cgtcgtagcagagaccgtggtgctagggatgtagagtatgatgaagttgaagaggttccc
gttaccaagtctagagataaagatcatgagcgtgaaagaaaaagaaagcgcagtcgttct
agggaccgtgaacgtaagaaggatcgtaaagaaagagatcatcatcgccgagacaagagt
aaagatcgccgtgataaacacgataaagacaattctgaacgtgatgacaaaattcatatt
aaacaagaacctgttgatgaatatgacaataattatgacaattacaataacgagtatgat
ggttacaacagtcctcatgatgattatgatccagatatggttaaaaaagaggaacccgat
gaagaaaatgcaaatggtagccgttacagtaataatgtaatatga

DBGET integrated database retrieval system