KEGG   Acyrthosiphon pisum (pea aphid): 100168877
Entry
100168877         CDS       T01076                                 

Name
(RefSeq) heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100168877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:api03019]
    100168877
   03041 Spliceosome [BR:api03041]
    100168877
Messenger RNA biogenesis [BR:api03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100168877
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100168877
Spliceosome [BR:api03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    100168877
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 100168877
NCBI-ProteinID: XP_001946219
APHIDBASE: ACYPI009542
UniProt: J9K9C9
Position
A2:63230394..63238316
AA seq 350 aa
MREPEHLRKLFVGGLDYKTTDENLKKYFEQWGEIMDVVVMKDPQTKRSRGFGFITYAAAH
MVDDAQGARPHKIDGRTVEPKRAVPKTDIGKPEAGATVKKLFVGLLNDSITEEDLKEYFS
PYGNVTSAALVVHKETGKKRGFGFVEFDDYDPVDKICLKGSHIIKGKKIDVKKALSKEEM
ARVNARNNSNSADNWGSDNRNAWEPTMRNFGRGGGWRSGNDPDPWESGPSSRGGNWGGPS
TSAWDNSFSDGYQQSFGAGPIRGSNGPLRGGGAARPGPYNSGFDSGYNDFSSGFSGSNFA
SGEGSSFGGRGRGGVRGRGGGPIRGISGRGPVNPSRGGRGAFGRGGRGRY
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgagggagcctgaacatttacgtaaattatttgtcggtggattagactataaaactaca
gatgaaaatctcaaaaaatattttgaacaatggggtgaaatcatggatgttgttgtaatg
aaagatccacagactaaacgatcaagaggatttggcttcattacttatgctgcagctcat
atggttgatgatgcacaaggtgcacgtcctcacaagatagatggtcggacagtagaacct
aagagagctgttccaaaaactgatattggaaaacctgaagcaggggcaacggttaaaaaa
ttgtttgtaggtctgttaaatgacagcataaccgaggaagacttaaaagaatatttttct
ccgtatggtaatgttacttctgctgccctagttgttcataaagaaacgggcaaaaaaaga
ggatttggttttgttgaatttgatgattatgatccagttgataaaatatgtttaaaagga
tcacatataataaaagggaaaaaaattgatgtaaaaaaagcattgagtaaagaagaaatg
gctagagtaaatgctagaaataacagtaattctgccgataattggggtagtgataatcga
aatgcctgggaaccaacaatgagaaattttggaagaggtggaggatggagaagtggtaat
gaccctgacccgtgggagtcaggccctagttctcgaggaggtaattggggaggtccatca
actagtgcttgggataatagtttcagtgatggctatcaacaaagttttggtgccggacct
ataagaggaagtaatggtcctttgcgaggaggtggagctgcaagacccggaccttacaat
agtggttttgatagcggttacaatgattttagtagtggatttagcggcagtaattttgcc
agtggtgaaggaagtagttttggtggaagaggaagaggaggtgttcgtggaagaggaggt
ggccctataagaggaatatctggaagaggtcctgtaaacccaagtcgtggtggtagaggt
gcttttggacgaggtggaagaggaagatactaa

DBGET integrated database retrieval system