KEGG   Acyrthosiphon pisum (pea aphid): 100168943Help
Entry
100168943         CDS       T01076                                 

Gene name
Scsalpha
Definition
(RefSeq) succinyl coenzyme A synthetase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00020  Citrate cycle (TCA cycle)
api00640  Propanoate metabolism
api01100  Metabolic pathways
api01200  Carbon metabolism
Module
api_M00009  Citrate cycle (TCA cycle, Krebs cycle)
api_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100168943 (Scsalpha)
   00640 Propanoate metabolism
    100168943 (Scsalpha)
Enzymes [BR:api01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100168943 (Scsalpha)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100168943 (Scsalpha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 100168943
NCBI-ProteinID: NP_001156571
APHIDBASE: ACYPI009606
UniProt: C4WXC2
AA seq 330 aa AA seqDB search
MAASTRVFSRIAVCNLMGIRSSSNTVDPRIYAETRKNLLLTKDTKVICQGMTGKQGTFHS
TQAIEYGTCMVGGVSPGKGGKTHLGLPIFNSVKEARDETGADATVIYVPPPGAAKAISEA
IDAEVPLIVCITEGIPQQDMVRVKHKLIRQNKSRLLGPNCPGIIAPEQCKIGIMPGHIHL
KGSVGVVSRSGTLTYEAVHQTSQVGLGQTLCVGIGGDPFNGTDFIDCLEVFLQDPNTHGI
ILIGEIGGQQEEMAAEYLIEHNTGPNAKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQ
DKINALEKAGVVVTRSPAAMGIELSKLMKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttccaccagggtcttctccagaatcgcagtatgcaatttaatgggcatacga
tcatcatcaaatacagttgatccgcgcatttatgcggaaactagaaaaaatttactactc
actaaggatactaaagtaatttgtcaagggatgactggtaaacaaggaacattccattct
actcaggctatagagtatggaacttgtatggtaggcggtgtctctcctggcaaaggtgga
aaaactcatttaggtttaccaattttcaactctgtcaaagaagcacgagatgaaactgga
gcggatgctacagttatttatgtaccaccaccgggcgccgcaaaagcaatctcagaagct
attgatgctgaggttcctttaattgtctgtattacagaaggaattccccaacaagacatg
gtacgagtgaaacataaattaattagacagaacaaatctagattgcttggacctaattgt
cctggaatcattgctccagaacaatgtaaaattggtattatgcctggtcatattcatttg
aaaggatctgttggtgttgtgtctcggtcaggtacacttacttatgaagcagttcatcaa
acatctcaagttggtcttggacaaacactgtgtgttggtattggtggtgatcctttcaat
ggtaccgattttatagattgcttggaagtatttttacaagacccaaatacacacggtatt
attctcattggtgagattggcggtcaacaagaagaaatggctgctgaatatttgatagaa
cataatactggtccaaatgccaaaccagttgtatcattcattgctggactaacagcacca
cccggtcgcagaatgggccatgctggagcaatcatatctgggggaaaaggtggagctcaa
gataaaattaatgcattagaaaaggctggtgtggtcgttactaggagcccagctgcaatg
ggaattgaattatctaaattgatgaagaagtga

DBGET integrated database retrieval system