KEGG   Acyrthosiphon pisum (pea aphid): 100168964Help
Entry
100168964         CDS       T01076                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00350  Tyrosine metabolism
api00360  Phenylalanine metabolism
api00380  Tryptophan metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100168964
   00360 Phenylalanine metabolism
    100168964
   00380 Tryptophan metabolism
    100168964
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100168964
Enzymes [BR:api01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100168964
    4.1.1.105  L-tryptophan decarboxylase
     100168964
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100168964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100168964
NCBI-ProteinID: XP_001950555
APHIDBASE: ACYPI009626
UniProt: J9K9K9
Position
X
AA seq 476 aa AA seqDB search
MEFKQFKEFSTDMIDYVGNYLENIRDRKVLSSVKPGYLRPLLPTEAPNDPENWKDVMSDV
EKLIMPGVTHWHSPRFHAYFPTANSYPAMVADILSDSIACIGFSWISSPACTELEVVMMD
WLAKMIGLPEIFLASAGLGGGGVIQGTASEATLVALLGAKARILQIMKEADSTVVDADIV
PKLVAYSSALSHSSVERAGLLGGVLLRALDTDGEHKLRGDTLRDAIAKDRADGLIPFFVV
ATLGTTSCCSFDRLDEIAEVGNAESIWVHVDAAYAGSSFVCPEYRHYMKGVELADSFNFN
PHKWLQVTFDCSAMWLRNPNYVINAFNVDPLYLKHELEGQMPDYRHWQIPLGRRFRSLKM
WFVFRLIGVANLQKSIRKDINLALEFAKRLENDPNYELFNEVSMGLVCFRLKGSNELNEV
LLKEINERGTVYMVPSKVKGTFFLRMAICSRYTQIEDIDVTWNEVYEAGKTVLSKQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaacagtttaaagaattttccacagacatgatcgattacgtgggaaattat
ttagaaaatattcgagatcggaaagtattgtcatcggtaaaacctggttacttaagacca
cttttaccaaccgaggcgcctaatgatcctgaaaactggaaagatgtgatgtctgacgtc
gaaaagctgattatgccaggggttactcattggcattctccaagatttcacgcttatttc
cctacggctaacagctacccagctatggtcgctgacatactgagcgattcaattgcttgc
ataggattttcatggatatcaagcccagcgtgtactgaattggaagtggtcatgatggat
tggttggctaaaatgataggcttgccagaaatcttcttagcctcagctggcctgggagga
ggtggagtaattcagggcactgctagcgaagccactttggtggcgttgttgggcgccaag
gcgcggatactgcagataatgaaagaggcggactcaacggtggtggacgcggacatcgtg
ccaaagctggtcgcgtactcgtctgcgctgtcccactcgtccgtggagcgcgctggcctg
ctgggtggcgtgttgctccgtgcgctggacacagacggcgagcacaaactccgcggcgat
acgctgcgcgatgccatcgccaaggatcgcgccgacggcctgatcccgttcttcgtggtg
gctacgctgggcaccaccagttgctgttcgttcgaccgcctggacgaaatcgccgaggtg
ggcaacgccgagagcatttgggtccacgtggatgcagcgtacgctggatcttcatttgtt
tgcccggaatatcgtcattatatgaaaggagtagaattagccgattcattcaatttcaat
cctcataaatggcttcaagttacttttgattgttcagcaatgtggctaagaaatccaaat
tacgtgataaatgctttcaacgtagatccgctttacttgaagcacgaacttgagggacaa
atgccggattacagacattggcaaataccgttgggccgccgttttcgttcgttaaaaatg
tggttcgtattccgtctaattggtgtcgcaaaccttcaaaagtctatcagaaaagatata
aatcttgcccttgaatttgccaaacgattggaaaacgacccaaactatgaacttttcaat
gaagtcagtatgggattggtgtgcttccgacttaagggatccaacgaacttaatgaagtg
ttattgaaagagataaatgaacgaggcacagtgtatatggtcccatcgaaagtcaaagga
acctttttcttgcgtatggctatttgctcgaggtacacacagattgaagatattgacgtg
acatggaacgaagtgtatgaagccggtaaaaccgtattgagtaaacaataa

DBGET integrated database retrieval system