KEGG   Acyrthosiphon pisum (pea aphid): 100169170Help
Entry
100169170         CDS       T01076                                 

Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00040  Pentose and glucuronate interconversions
api01100  Metabolic pathways
Module
api_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100169170
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     100169170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Rab15_effector
Motif
Other DBs
NCBI-GeneID: 100169170
NCBI-ProteinID: XP_001946038
APHIDBASE: ACYPI009811
UniProt: J9KA30
Position
A1
AA seq 273 aa AA seqDB search
MFRSINKLSTQLNNRYVMGTLSRGIAEKRSSMEEYFKDKSFIVTGASAGMGKVIAGRLLA
MDAHVFAVGRDIDSLPSIPGLKLTKVTVDIGDWDSTYSKILEMGPVHGLVNNAGVAHIEP
FMKTTQQGWDDTLNINSRGVVRASQAVAENMIAAKINGSIVNISSTISERAIPDHVAYCA
SKGAVNQITRTMAVELGPLGIRTNNVNPTVVLTKMGLIAWSDPKKSEPIMKRIPLGRFAQ
PNDIADAVIFLLSDYSKMINGMNLYVDGGFMTG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgctctatcaacaagttatcaacacaattgaacaaccgttacgttatgggaact
ctatccagagggatagctgaaaaacgttcgagtatggaagagtatttcaaagacaagagc
ttcatagtgactggagcaagtgctggtatgggaaaagtgattgctggaagattgttagct
atggacgcgcacgtattcgcagtcggaagagatatagatagtctaccgagtattcctggc
ctaaaactgaccaaagtaaccgtggatattggtgactgggattcgacatatagtaagatc
ttagaaatggggcccgtccacggtttggttaacaacgccggagtggctcacatcgaacca
tttatgaagacaacacaacaaggatgggatgatacattaaacataaattccagaggagtg
gtaagggcaagtcaagctgtagctgaaaatatgattgctgcgaaaatcaatggatcaata
gtgaatatatcctcaaccatatctgagagagcaataccagatcatgtagcatattgtgca
tctaaaggagctgtgaaccaaattacaaggacaatggccgtagaattaggacctctcggc
ataagaacaaacaatgttaatcctactgttgtattgaccaagatgggattgatagcgtgg
tctgatccgaaaaaatcagaaccgattatgaaaagaataccattaggaagatttgcacag
cctaatgatattgctgatgcagtgatatttctattgagcgactattcaaaaatgataaat
ggtatgaacctatacgtagatggcggttttatgactggatga

DBGET integrated database retrieval system