KEGG   Acyrthosiphon pisum (pea aphid): 100569161Help
Entry
100569161         CDS       T01076                                 

Definition
(RefSeq) gem-associated protein 5
  KO
K13133  gem associated protein 5
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03013  RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100569161
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:api03019]
    100569161
   03041 Spliceosome [BR:api03041]
    100569161
Messenger RNA biogenesis [BR:api03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100569161
   mRNA cycle factors
    P-body specific factors
     100569161
Spliceosome [BR:api03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100569161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 RAB3GAP2_N
Motif
Other DBs
NCBI-GeneID: 100569161
NCBI-ProteinID: XP_003247819
UniProt: J9LLJ4
Position
Un
AA seq 1457 aa AA seqDB search
MNTFEITQSMNWYKSNVMTMDDCGKLIAYGSRSIIVLVSGLDGKSVYDLQYNRLRLNTKL
GCGRIGAVSFSPKTDFLEDAHYLASIDEVNIYIWKVKSMVCDHIHSFGNKKSKNITLVDV
TWLYGCLTVVALSDAGTLHKWDIQALTMRNYTLDIKASPLTLAACPHKKNLVAIGCKNGH
LFVYDLTGDGKLLHKLHYHERNINSLAWCPVPYSPLNSDQSVEPLLLASIACDRTGLCIS
RAGLDMFNETTIALPMRPMRKSTFRNKNNLIWSCVKWIKPSILIVTSGFGEIIKIELRPD
LVCGPIVSLISDSHKDIIFSIACPRESTNLYLWSSCMGRKLIRTPLLRSKEETPELPLEV
PTLGGFVYCFSLSPVNSADFAFGLGDGRIYYWNVSNKRQLELITLSQSVDSKVLSLAFHP
QDEGLLAYATGDGRVGVFNLTKKRNNNNLLKTVLANPIYRLCWAPFPNTKMVNDAKLALY
AVGNGQIVIYNDMSLWTDPFHLKDYTQFNEIEDKLTTPVKRIEMAWKPNYDVVAIGNSNG
SIYLLDGNTLKLKHVVNGHDQSVECIIWHPTHVTSDYSEESKYKNYFASSSHCIRVHQLN
EDCTPSLVVEFKGHKEKINELAWSPHHNLILLSCSNDFTAKVWNVEKCTLIGVYSKHLST
VLCGIFSPCDADIVFTGSADHSIHSWRLSKDLHNYTTEFKKNQDTPNIVKEKIVTKVADN
STTDSSKEQSNKIQQFPLSSYELFIGKHLEKAVDKFINSKYLNNVSVDEEINYLAFFGTN
TEMKQFLVNEYSALRKKSSNQIIPCMNNINIWGQNLEGYFKDAIATKTISDWMIAVAPSV
SYELWTKMCDVYASQLEDVGEVTKASTYLVAIKKYDEAATMLLKNNLFREALAVVKSQDK
QNDEIVLEITKKWGEYNILHGHPKEAAHCFLSIGDTRNAILCLIKIKQVKELSLAAKLAR
YIDEDMEESLVVNLLKTEYFRHHTWNEARELLKNHPKLDYLNMWTGVHEAMYELDPKVTH
IIIKNWICATPNEENCSILNYILEHVENKPDYYDKLLKIVGSEFISDASLLMPMITVFLA
GQFCLIALQYQKTGMFTLDSQTRLIKCFALAYNYETVYTDSNSKFNKILSRLIMWIFPKG
PLTLDSYVHFELNDNLIKSIRAYLCYTCFSWLKPLYTSINKKLNLPVDEDISDNEKYFSE
IIILTQQFQQLLNNYIHDIMDLETSNYFKAKKEIERINQLLTTSSTEVNIGGSINEEVIG
CIKSIKSKDENQNTEILDSKVIITSEANELKDVKSLIENMKECNIDNISNFNKLEHEESN
SLQNKKFNNLQNNNNASTDCDIVCTNDNPTKIHEIHLEENNSLANSNDLLVERETCKKEV
YQFYQNLKSEINKFNLNDQSPVKHIAHLEIEASKKKELEQIVTEFEDKRINSPNPFLFIA
ELKKFIHDLDINFKYEN
NT seq 4374 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttttgagattacccagtcaatgaactggtacaaatctaatgtcatgactatg
gacgattgtggaaagctaattgcatatggctcaagatctatcattgtattagttagtggt
ttggatggtaaaagcgtctatgatttacaatataaccgtcttagactgaatacaaaattg
ggttgtggtcgtattggagctgtatcattttctcctaaaactgattttttagaagatgca
cattatttggcttctatagatgaagttaatatttacatctggaaagtaaaaagcatggtc
tgtgatcacatacattcatttggaaataaaaaaagtaagaacataactctggtggatgtt
acatggttgtatggatgtttaaccgttgtagcattgtcagatgctgggactttacacaag
tgggatattcaagcattaacaatgcgtaattatacgttagatattaaagcatcaccttta
acattagcagcttgccctcacaaaaagaatttagttgctataggatgtaaaaatggtcat
ctatttgtctatgacctaactggtgatggcaaattattacacaaattgcattaccatgaa
agaaatataaattcattggcttggtgtccagttccttatagtccattgaattctgatcaa
tctgttgaacctttattactagcatcaatagcatgtgatagaactggtttatgtataagt
cgtgctggtttagatatgtttaatgaaactaccattgcattacctatgagaccaatgaga
aaatctacattcagaaataaaaataatttaatttggagctgtgttaaatggataaaacct
tcaattcttattgttacatctggttttggagaaattataaaaatagaacttagaccagat
ttggtatgtggaccaatagtgtctttgattagtgattcccacaaggatataattttttct
atagcatgtccacgggaatcaaccaatctttatttatggtcatcgtgcatgggtagaaaa
ttaattcgaactcccttactaaggagtaaagaagagacccccgaattaccattggaagtt
ccaacgcttggtggttttgtgtattgtttttcactatccccagttaattcagctgacttt
gcatttggtcttggcgatggaagaatttattattggaatgtatctaacaaacgtcaatta
gaactaattacactgagtcaatccgtagactcaaaagtcttatctttagcatttcatcca
caagacgaaggtttgttagcatatgctacaggtgatggacgtgttggagtttttaattta
acaaaaaaaaggaataataataatttgttaaaaactgtacttgctaatccaatttaccgg
ttatgttgggcaccatttccaaatacgaaaatggttaatgatgcaaaacttgctctttat
gcagttggtaatgggcaaattgtaatttataatgacatgagtctttggacagatccattt
catttaaaagattatactcaatttaatgaaattgaagataagctaacaacgcccgttaaa
cgtattgaaatggcttggaaaccaaattatgatgtggttgcaataggaaattcaaatggg
agcatttatttattagatggaaatacattaaaacttaaacatgtagtgaatggtcatgat
caatctgttgagtgtattatctggcatccaacacatgtaacttctgattatagtgaagaa
tccaaatataaaaattattttgcatcaagttcacactgcattagagtccatcaacttaac
gaagattgtacgccgtcattggttgttgaatttaaaggacacaaagaaaaaatcaatgaa
ctagcatggagtcctcatcataatttaatacttttgagttgttcaaatgattttactgcc
aaagtatggaatgtggaaaaatgtacacttattggagtttattctaaacatttatccact
gtgttgtgtggaatattctcaccttgtgatgctgatatagtatttactggctctgctgat
cactctatccattcatggcgattatcaaaagatttacacaattatacaactgagttcaaa
aaaaatcaagatactcctaatattgttaaagaaaaaattgttacaaaagttgctgataat
tctacgactgattcaagcaaagaacaatcaaataaaattcaacagtttccattatcaagt
tatgaactttttattggaaaacatttagaaaaagctgtagataaatttatcaattcaaag
tatttaaacaatgtgtcagtagatgaagaaataaattatttggcattttttggtacaaat
actgaaatgaaacagtttttagttaatgaatacagtgcattaagaaaaaagtcttcaaat
caaattattccttgtatgaacaatataaatatatggggtcaaaacttagaaggttatttt
aaggatgcaattgcaacaaaaactatcagtgattggatgatagctgttgccccaagtgtt
agttatgaattatggactaaaatgtgtgatgtatatgccagtcaactagaagatgttgga
gaagttactaaagcatcaacatatttagtagctataaaaaaatatgatgaagctgcaacg
atgttactaaaaaataatttgttccgcgaagctttagcagtcgttaagagccaagataag
caaaatgatgagattgtattagaaataactaaaaagtggggtgaatacaatattcttcac
gggcatcccaaagaagctgctcattgttttctgagtattggtgatacgcgaaatgctatt
ttatgccttataaaaattaagcaagttaaagaattgtcattagctgccaagttagctagg
tatatagatgaagatatggaagagtcattggttgttaatttattgaaaaccgaatatttt
agacatcatacatggaatgaagctagagagcttctaaaaaatcatcctaaacttgattat
ttaaacatgtggactggtgttcatgaagcaatgtatgagttagatcccaaagtaactcat
attataattaaaaactggatttgcgctacaccaaacgaggaaaattgttcaattttaaat
tatattttggagcatgtagagaataaaccagattattatgacaaattactaaaaatagtg
gggtcagaattcatttctgatgcttcacttttgatgccaatgattactgtattcttagcg
ggccagttctgtttaatagctttacagtatcaaaaaactggaatgttcactttagattct
caaacgcgtttaataaaatgttttgcacttgcatataactatgaaacagtgtatacagat
tccaattcaaaatttaataagatcctttctagattgattatgtggattttccctaaagga
cctttaacattggattcatatgtacattttgaattgaacgacaacttgataaaatcaatc
cgagcttatttatgttatacttgtttttcatggttgaaacctttgtatactagtataaac
aaaaaactaaacttgccagttgatgaagatatttctgacaatgaaaaatatttcagtgaa
attattattttaactcaacaatttcaacagttacttaacaattatattcatgatataatg
gatttagaaacttcaaactactttaaagctaaaaaagaaattgaacgcataaatcagtta
ctgactactagctctactgaagttaacattggtggttcgataaatgaagaggtaattgga
tgtataaagtcaataaaaagtaaggatgaaaatcagaatactgagattttagacagtaaa
gtaataataacttcagaagccaatgaattaaaagatgtgaaatctttaattgaaaatatg
aaagaatgcaatattgacaatatatctaattttaacaagttagaacacgaagaatcaaat
tcgcttcaaaataaaaaatttaataatctacaaaataataataatgctagtacagattgt
gatatagtttgtacaaatgataaccctacaaaaatacatgaaatacatttggaagaaaac
aattctcttgcaaactcaaatgatttgctcgttgaaagagaaacatgtaaaaaagaagta
taccaattctatcaaaatctcaaatcagagataaataaatttaatttaaatgatcagtcg
cctgtcaagcatattgcccatttagaaattgaagcctcaaagaaaaaagaacttgaacaa
attgtgacagaatttgaagataaacggataaattctcctaatccgtttttatttatagca
gagttgaaaaaatttatccatgatcttgatatcaactttaaatatgaaaactaa

DBGET integrated database retrieval system