KEGG   Acyrthosiphon pisum (pea aphid): 100570018
Entry
100570018         CDS       T01076                                 

Definition
(RefSeq) protein takeout
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB
Motif
Pfam: JHBP
Other DBs
NCBI-GeneID: 100570018
NCBI-ProteinID: XP_003247111
UniProt: C4WUR2
Position
A3
AA seq 258 aa
MAKSLLIVSALFLAVVASVTAAPTPKKQIAFNLCKKSDPNLDRCLKTSIQSVIPDLAEGY
PKLRIPAIEPFELPSLEIEHGKGSSKAVSIDLKLKDVKIMGLTSAVVDALKVDVDNFKTS
GKISFTKPLEITGQYTVNGKVLVLPITGNGPCSIVLNEPVLELEEMSGTPFEKNGKTFVQ
IKKVNLKVASVKNLNVKLENLFNGNKQLGDSMNSILNQNWEVLLEELKPAFEEAIGAISQ
DIVNKVFQKTAYSDIFLL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcaaaatcgttgctgatcgtttctgctttatttttggccgtcgttgcatctgtaaca
gctgcacccacaccgaaaaagcaaatagctttcaatctatgcaagaaaagtgatccaaac
cttgacagatgtttgaagacctccatccaatcagttattccggatttggccgaaggatac
ccgaaattgaggattccggccatcgaaccgttcgagttaccgtcattggaaatcgaacac
ggaaagggctctagcaaagctgtcagtattgacttgaagttaaaggacgtcaaaatcatg
ggtttgaccagcgcagtggtcgatgccttgaaagtcgacgtggacaacttcaagacgagc
ggcaagattagcttcacaaagccactcgagatcactggacaatacacggtcaacggcaag
gtgctcgttttgccgatcaccggaaacggaccgtgttccattgtcttaaacgaacccgtt
ttggaattggaagaaatgtccggtactccattcgagaagaacggtaagaccttcgttcaa
atcaagaaagtcaacctgaaggtggctagcgtcaaaaatctgaatgtcaagttggaaaac
cttttcaatggaaacaaacaattaggcgatagcatgaactccatcctgaaccaaaactgg
gaagttcttcttgaagaattgaaaccagcattcgaagaagcgattggagctatctcgcaa
gatatcgtcaacaaagtatttcagaagaccgcgtactcagacatattccttttgtaa

DBGET integrated database retrieval system