KEGG   Acyrthosiphon pisum (pea aphid): 100570817Help
Entry
100570817         CDS       T01076                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00601  Glycosphingolipid biosynthesis - lacto and neolacto series
api00603  Glycosphingolipid biosynthesis - globo and isoglobo series
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100570817
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100570817
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:api01003]
    100570817
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     100570817
Glycosyltransferases [BR:api01003]
 Glycan extension
  P blood group
   100570817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB Caps_synth
Motif
Other DBs
NCBI-GeneID: 100570817
NCBI-ProteinID: XP_003244188
UniProt: J9LHB6
Position
X
AA seq 352 aa AA seqDB search
MFCWPYLKRNIIFRIIFLLLISIVIVYNLNFLSSIDQFLNSSQKHLISCYFEEKQDNSLL
ELNPEEVTKNSIFFVETSCNHKKGINLSLRQGCAIESAANLNPNLNIFVLFVAPSFISDE
SEIINRFKMYSNVNLRYINFVKYSHNTPLQDFVASNTISTSQWPVSHASDLLRFLTLWKF
GGTYLDLDVVLMKSLEGLSNFASIESNTSVASLVLNFDVDKIGRTVSNTSINDFASNYYA
NDWGYNGPGVITRTLEKICNTNLVTDMNKQKCKGFMVFGTEAFCPISWTDWRLYFNTNTS
DEVMVKLKDSIGIHVWNLHSKHTPINIGSKQPYGLVAEKYCPIIFSMAKSVF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttttgctggccatatttgaaaagaaatataatttttcgtattatatttttactactt
atttctatagtaattgtgtataatttaaattttctaagtagtattgaccaattcttaaat
tcatctcaaaaacatttaatttcttgttactttgaagaaaaacaagataattctttactt
gaattaaatcctgaagaagtaacaaagaatagtatattttttgttgaaacatcatgtaac
cataaaaaaggaattaatttgagtctgagacaaggctgtgctatagaatctgcagcaaat
ttaaatcctaatttaaatatatttgttttatttgttgctcctagtttcataagcgatgaa
tctgaaattattaatagatttaaaatgtattcaaatgttaatttaagatacatcaatttt
gtaaaatattctcataatactccattacaagactttgtggcctcaaacaccatatccaca
agtcaatggccagtttctcatgcaagtgacttgttgagattcttaacattgtggaaattt
ggagggacttatttggacctagatgtagttctaatgaaatctttggagggcctatcaaat
tttgcaagtattgaatcaaacacttcagttgcctcacttgtattgaactttgatgttgat
aaaattggaagaacagtttcaaatacttcaatcaatgattttgcttctaattattatgca
aatgattgggggtataatggtcctggtgttattaccagaacacttgaaaaaatatgtaat
acaaatctggtaactgatatgaataagcaaaagtgtaaaggatttatggtttttgggaca
gaagcattttgtccaataagttggaccgattggaggctatactttaatacaaacactagc
gatgaagtaatggttaaacttaaggatagtattggtattcatgtatggaatttacatagt
aaacacacacctattaatataggttcaaaacagccatatggtttagttgcagaaaaatat
tgtccaattattttttctatggcaaagtctgtattttaa

DBGET integrated database retrieval system