KEGG   Acyrthosiphon pisum (pea aphid): 100571094Help
Entry
100571094         CDS       T01076                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 2-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00230  Purine metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100571094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:api01001]
    100571094
Enzymes [BR:api01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100571094
Protein kinases [BR:api01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100571094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 100571094
NCBI-ProteinID: XP_029343215
Position
A1
AA seq 191 aa AA seqDB search
MSLMSQCDYGRQIFIQTAFYKGNKVALKTLKRSRLELTRPRLLELKRLKDLHHDHLVRFY
GACIEPNYCCLLTEYCPKGSLQDILENEQFKLDWMFRYSLMHDIVKGMCYLHSSELRSHG
GLKSSNCVVDSRFVLKIADFGLRSLRNNHTNESNSDSDSYAYWKGLCNYYFYILQVGAIK
NIYIFGMKYEF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatgagccaatgtgactacggacgccaaatattcatacaaacagcattttac
aaaggtaataaagtagcgctaaaaactttaaagagatcgcgcttggagttgacgcgtcct
cggctactggaattgaaaaggttgaaagatttgcatcatgaccatttagtgcgattttat
ggagcgtgcatagagcccaattactgttgtctactgaccgagtattgtcccaaaggaagt
ttacaggacattctcgaaaacgaacagtttaaactggattggatgttccggtacagtctg
atgcacgacattgtcaaaggaatgtgctatttacatagtagcgaactccgttctcacgga
ggtctcaaatctagcaactgtgtagttgatagcagatttgttcttaaaattgctgacttt
ggtcttagaagtcttcgaaacaaccatacaaatgaatcaaatagcgacagtgattcttac
gcttactggaaaggtttgtgcaattattatttttatattttacaggtaggtgctatcaaa
aatatttatatctttggtatgaagtatgaattttag

DBGET integrated database retrieval system