KEGG   Acyrthosiphon pisum (pea aphid): 100572734Help
Entry
100572734         CDS       T01076                                 

Definition
(RefSeq) retinal dehydrogenase 1-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00010  Glycolysis / Gluconeogenesis
api00053  Ascorbate and aldarate metabolism
api00071  Fatty acid degradation
api00280  Valine, leucine and isoleucine degradation
api00310  Lysine degradation
api00330  Arginine and proline metabolism
api00340  Histidine metabolism
api00380  Tryptophan metabolism
api00410  beta-Alanine metabolism
api00561  Glycerolipid metabolism
api00620  Pyruvate metabolism
api00981  Insect hormone biosynthesis
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100572734
   00053 Ascorbate and aldarate metabolism
    100572734
   00620 Pyruvate metabolism
    100572734
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100572734
   00561 Glycerolipid metabolism
    100572734
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100572734
   00310 Lysine degradation
    100572734
   00330 Arginine and proline metabolism
    100572734
   00340 Histidine metabolism
    100572734
   00380 Tryptophan metabolism
    100572734
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100572734
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    100572734
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100572734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100572734
NCBI-ProteinID: XP_003243566
Position
A2
AA seq 242 aa AA seqDB search
MEEAAKSNLKRVSLELGGKSPLVIFDDYDVDEAAKIAHDSVFVNMGQNCCAASRTFVQEN
IYDAFVKKAAELASNKKVGDQFDANTQIWPLVSEEQYNRVLSYIESGKKEGAKLEAGGSK
VGDTGYYVYPTVFSNVTDNMKIAREEIFGPVQQIIKFKTLDEVINRANDTKYGLAAGILT
KNMDTAMKYMDNINAGSVWINSYLVYSAQITFGGFNQSGLGRELGEDGLKEYLEIKTVSI
RQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagctgccaagtctaatttaaaacgtgtttcattagaattaggcggtaaaagt
cctcttgtaatatttgatgattatgatgtcgacgaggctgctaagattgctcatgattca
gtatttgtcaacatgggtcaaaattgttgtgctgcttctagaacatttgttcaagaaaac
atttatgatgcatttgtcaaaaaagctgcagaattggcatctaataagaaagttggagac
caatttgatgccaatacacaaatatggcctttggtaagcgaagaacaatacaacagagtc
ttgagttatatcgaatctggtaaaaaagaaggtgccaaattagaagccggtggatctaaa
gtaggagacacaggttattatgtgtaccctactgtattttcaaatgtgactgacaatatg
aaaattgctagagaagaaatatttggaccagttcagcagattattaaattcaaaactttg
gatgaagtgataaaccgagctaatgacactaaatatggattggctgctggaatattaact
aaaaatatggatactgccatgaagtatatggacaatattaatgctggttcagtttggatt
aacagttaccttgtctattcagcacaaatcacatttggaggatttaatcaatctggactt
ggcagagaattaggagaagatggtttaaaagagtacttggaaatcaaaactgtctcaatc
agacaataa

DBGET integrated database retrieval system