KEGG   Acyrthosiphon pisum (pea aphid): 100573063Help
Entry
100573063         CDS       T01076                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00350  Tyrosine metabolism
api00360  Phenylalanine metabolism
api00380  Tryptophan metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100573063
   00360 Phenylalanine metabolism
    100573063
   00380 Tryptophan metabolism
    100573063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100573063
Enzymes [BR:api01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100573063
    4.1.1.105  L-tryptophan decarboxylase
     100573063
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100573063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 100573063
NCBI-ProteinID: XP_008186623
UniProt: X1WYI9
Position
Un
AA seq 203 aa AA seqDB search
MDSESFRVCGKTVIDYIADYVDNIRDRPVLSSVKPGYLYELVPPEAPVKGEDWKTVLDDV
ENIIMPGITHWNSPQFHAFFPTGNSYPAIVGDMLCNAIGSIGFSWITSPACTELEVQVMN
WFGKILDLPKEFLNESEGPGGGVLQGSASEATFVCLLAAKDRTTKRIKALDPSMTDGEIK
AKLVAYTSGKFLRETPPVRKLDR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggattccgaatcgttcagagtatgcgggaagaccgttatcgactacatcgcagactac
gtggacaacattcgagacaggcccgttctgtcctccgtcaaaccaggttatctctacgaa
ttggtgccgcccgaggctccagtcaaaggtgaagattggaagacggtgttggacgacgtg
gagaacataatcatgcccggcattacacattggaactcgccgcagtttcatgcgtttttc
ccaaccggaaactcttatccggccatcgtcggtgacatgctgtgcaacgccatcggatcc
ataggattttcttggataacgagtccagcgtgtactgaactcgaagtgcaagttatgaat
tggtttgggaaaatcttggacttgccgaaagagttcttgaacgagtccgaagggcccggt
ggtggcgtacttcagggcagcgccagcgaagctacgttcgtgtgcctgttggcagccaaa
gaccgcacgacgaagcggatcaaagcactcgacccgagcatgactgacggtgagatcaag
gcgaaactggtggcttacacttccggtaagtttttacgggaaacaccacctgttagaaaa
ctcgatcgataa

DBGET integrated database retrieval system