KEGG   Acyrthosiphon pisum (pea aphid): 100574136Help
Entry
100574136         CDS       T01076                                 

Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00740  Riboflavin metabolism
api00860  Porphyrin and chlorophyll metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100574136
   00860 Porphyrin and chlorophyll metabolism
    100574136
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100574136
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     100574136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD adh_short DapB_N
Motif
Other DBs
NCBI-GeneID: 100574136
NCBI-ProteinID: XP_003248623
UniProt: C4WRU5
Position
A1
AA seq 205 aa AA seqDB search
MKKIAIFGATGMTGLCTVEAALKQGLEVRALLRDPSRMPEELRKQVEVITGDVLVKEDVD
KVVEGRDAIVVTLGTRNDLAPTTIMSEGLRNILSSMEKNNVKIVSVCLSTFLFYDKPKVP
AMFHGINDDHERMLHLLQAAESLDWIAVMPPHIAGTPSGDYSVEIGSSPGRAISKYDLGK
FMIECLSKPDYYKQRCGLATKVPAP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcaattttcggggccaccggcatgacgggactgtgcaccgttgaagcc
gctttgaaacaaggtctagaagtcagggctctcctgagagatcccagtcgtatgcccgaa
gaacttcgcaaacaagtagaagtgattactggcgatgttttggtcaaagaagacgtggac
aaggtcgtcgagggcagagacgcgattgtcgtgactttgggaaccagaaatgacttggct
cctaccacaataatgtccgaagggttgagaaacattttatcatcgatggaaaagaacaat
gtgaaaatcgtatctgtgtgcttatccacctttttattctacgataagcccaaagtgcca
gcaatgttccacgggatcaatgacgatcacgagcgaatgttgcatttgctacaggcagcc
gaatctctggattggattgctgtgatgccaccacatattgccggcactccgtcaggcgat
tacagcgtggaaatcggctcatctcccggtcgtgccatatctaaatatgatctcggaaag
tttatgattgaatgtttatctaaacccgattactataagcagagatgcggtttggcaacc
aaagtaccagctccatga

DBGET integrated database retrieval system