KEGG   Acyrthosiphon pisum (pea aphid): 100574594Help
Entry
100574594         CDS       T01076                                 

Definition
(RefSeq) cell division cycle-associated protein 7
  KO
K23408  cell division cycle-associated protein 7
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:api03036]
    100574594
Chromosome and associated proteins [BR:api03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    100574594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-4CXXC_R1 MazG
Motif
Other DBs
NCBI-GeneID: 100574594
NCBI-ProteinID: XP_003245746
UniProt: J9LIE7
Position
X
AA seq 355 aa AA seqDB search
MSAPINEGASTSAGLSEYELLRQENMNKLKHEVGDIFSNALQCAQNLKKKLRLRSGRRAA
HIPGLRVKLFSKLEKSSKAKEAQRKDIRRSSRSKRKQIYYDSKDENNNGKNKKCRQKLKQ
QKKCPSPKSKVSKRTFSRKVSRLDASLVTKEMIDNINYRSVGKKYSTDKGTTCHQCRQKT
LDQKSYCRHQSCKGMRGMFCGFCLGKRYGEDVAEALLNPVWACPPCRGQCNCSICRRHQG
KDPTGQMAQEAKAKGYNSVCDMLRTIEGDPCEPQNHNPVENHIELQNSNVVSFTGTQLKN
DVAVFDEHKSENKVKNLKSISKDEEQCNSKNYIEEQRETSEMVIDKLYEKLMAST
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccgatcaacgagggggcgtccacctcggctggtctgtcagagtacgaactc
ttacggcaagagaacatgaataaactgaagcacgaggttggcgatatatttagtaacgct
ctgcaatgtgctcagaaccttaaaaaaaagttgcgattacgaagtggtagaagggcagct
catataccagggctacgagtgaaattattctctaaactggaaaaatcgtcaaaggcaaag
gaggctcaaagaaaagatatccgtcgatcatcacgttctaaaagaaagcaaatttattat
gattctaaagatgaaaataacaatggaaaaaacaaaaaatgtcgacagaaattaaaacaa
cagaaaaagtgtccatctcctaaatctaaagtttcaaaacgaacatttagcagaaaagta
tctcgattggatgcatctcttgtaacaaaagaaatgatagacaacatcaattatcgctct
gtaggaaaaaaatatagtaccgataaagggacaacttgtcaccaatgcaggcagaaaact
ttggaccaaaaatcatactgtcggcaccagagttgtaaaggtatgagaggtatgttctgt
ggtttttgtttgggtaaacgatatggtgaagatgtagctgaagctttattaaatccggta
tgggcttgtccaccatgtcgaggtcaatgtaactgcagcatttgtaggcgtcatcaaggc
aaagatccaactggacaaatggcacaagaagccaaagctaaaggatataactctgtttgc
gatatgttaaggacaatagaaggagatccatgtgaaccgcaaaatcataatcctgtagag
aaccacattgaacttcaaaacagtaatgtagttagttttaccggtacccagttaaagaat
gatgtggctgtatttgatgaacacaagtctgaaaacaaggtcaaaaatttaaaatcaatt
agtaaggatgaagaacaatgtaactctaaaaattatatagaagagcaaagagaaacttca
gaaatggttattgataaactttatgagaaattaatggcttctacataa

DBGET integrated database retrieval system