KEGG   Acyrthosiphon pisum (pea aphid): 100575029Help
Entry
100575029         CDS       T01076                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:api01002]
    100575029
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100575029
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100575029
Peptidases [BR:api01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100575029
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100575029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_3 Abhydrolase_6 Abhydrolase_2 Abhydro_lipase Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100575029
NCBI-ProteinID: XP_003243739
UniProt: J9L398
Position
Un
AA seq 353 aa AA seqDB search
MAPCMCFSFMKPVMIFLLICVFATCCITSSFFAIILFLVFIIIPIVFRYSPSLQRGMIFL
NYVRMPSSVNYSHPEMYGIRGTRNFHIKTNDNMTLGVWHVLPRNLLEKYEDDNSTYEQLL
SHGEPIVIYMHGNSGTRANEHRVQLYHVLQDINCHVIAVDYRSYADSTDVEVSELGVVTD
AMEMFRWVHKRANGTPIFGWGHSLGTGIGAHAYSLLEKEGLYPNGLILEAPFTKMSDEIR
EYPLTKIHRLLPWFEFFIIEPVEKNNIIFDTETNLMNTKMPILILHARDDIVIPYQLGEK
LYKHLLETRKNVNTELVLYDKHFKYGHKHICKDKELGNRTRKFINESINNSPQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcaccatgcatgtgtttttcatttatgaaacctgtgatgatattcttgttaatttgt
gttttcgcgacatgctgcataacatcaagtttttttgcgataatattatttctcgtattc
ataattataccaattgtttttcgatattcgccatcacttcaaagaggaatgatatttcta
aattatgttcgtatgccatcttcagttaattatagtcatccagaaatgtatggtatcaga
ggaactagaaatttccatataaaaacaaatgacaatatgacattgggtgtctggcatgtt
ttacctcgtaatctgttggaaaaatatgaagatgataattcaacttatgaacaacttttg
agtcacggtgaaccaatcgtgatatatatgcatggcaactcaggaacacgagcgaacgaa
caccgggttcagttgtaccatgtgcttcaagatattaactgtcatgtaatagcagtagat
tatagaagttatgctgattctactgacgtcgaagttagtgagcttggcgtggttacggat
gcaatggaaatgtttagatgggtgcataagcgtgctaatggcacccctatatttggctgg
ggccattctttaggaacaggaatcggagcgcatgcatattcactgttggaaaaagaaggt
ctttatccgaatggcctcatactagaagctccatttacaaaaatgagtgacgaaatacgc
gaatatccgcttactaagattcatcgactattgccttggtttgagtttttcatcattgaa
ccagttgagaaaaataacatcatttttgatacagagacgaatttgatgaatactaaaatg
ccaatattgattttacatgcacgtgatgatattgtaataccttaccaactaggtgaaaag
ttgtacaaacatctattggaaactagaaaaaatgttaatactgaattagtgttgtacgac
aaacattttaagtatggacataagcatatatgtaaagacaaagaattaggaaatcggact
aggaaatttatcaacgagtctataaacaattcacctcaataa

DBGET integrated database retrieval system