KEGG   Acyrthosiphon pisum (pea aphid): 100575870Help
Entry
100575870         CDS       T01076                                 

Definition
(RefSeq) protein mono-ADP-ribosyltransferase PARP12-like
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100575870
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100575870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP
Motif
Other DBs
NCBI-GeneID: 100575870
NCBI-ProteinID: XP_003241017
UniProt: J9KLU0
Position
A3
AA seq 186 aa AA seqDB search
MSTQHIRFSQSKMLRKMYRRELLEDYDDYEYSRKSFFTKIDSNFNILKVQKINNPQLYGL
YLLHKEEMKLDNSIGDVREETLFHATSVKNAKSIARNNIDWRLTGRTRFGKGACFSPNAP
YAHQYAGRKGAFVVVKVLVKKFETTGINYDLEIPSTNCDTTLGNEGNVYVKYDDHTFIPK
YIVHYS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacaacatatacgtttttctcaatcaaaaatgttgagaaaaatgtataggaga
gaactactagaagactatgatgactacgaatattccagaaaatcattttttaccaagatc
gacagtaattttaatattttgaaagtacaaaaaattaacaaccctcaactgtatggctta
tatttattgcataaggaagagatgaaactagataatagcatcggtgacgtaagagaggag
acattgtttcacgcaacatccgtaaaaaatgcgaaaagtattgctcgtaacaatattgac
tggcgattaacagggagaaccagatttggaaaaggtgcgtgtttttcaccgaatgcacct
tatgcccatcaatatgcgggcaggaagggagcatttgtagttgtgaaagtgcttgtaaaa
aaatttgaaacaacaggcattaattacgacctagaaataccttcgacaaactgtgacact
acactaggaaacgagggaaacgtttatgtcaaatacgacgatcatacttttatcccgaaa
tatattgttcattattcctaa

DBGET integrated database retrieval system