KEGG   Acyrthosiphon pisum (pea aphid): 103311164Help
Entry
103311164         CDS       T01076                                 

Definition
(RefSeq) uncharacterized protein LOC103311164
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103311164
Enzymes [BR:api01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     103311164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 103311164
NCBI-ProteinID: XP_008188955
Position
Unknown
AA seq 255 aa AA seqDB search
MGQFAVSREWQENTDICIGLMNNALAGGADLLVLPEGVLARDIADPDLVLKAAQPLDGPF
ITQLLAVSKGNDLTTMMSVHVPTEGNKALNVLIAIRNGELIAAYEKLHLYDAFAMQESQR
VNPGNEIPPLVEVAGMKVGLMTCYDVRFPELARRLVLDGADVLVLPAAWVKGPLKEMHWE
LLCTARALENTCYMVAVGECGPRNIGNSLVIDPLGVAIAKAPESAALVFADLDPQRIAYA
PQRTAGAGKPPFCTS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggggcagtttgctgtcagccgggaatggcaggaaaacaccgatatctgcatcggttta
atgaacaatgcacttgctggaggcgcggatttactggtcctgcctgaaggcgtgctggcg
cgtgatattgccgaccctgatttggtactgaaagccgcacaaccgctggatggccctttc
atcacacagttgctggcggtcagtaagggcaacgatttaaccaccatgatgagcgtgcac
gtgccgacagagggcaacaaggcgctcaacgtgctgattgccattcgcaacggtgaactc
atcgccgcctacgaaaagctgcatctttatgatgcgtttgcgatgcaggagtcacagcgc
gtgaatccaggcaacgaaatcccaccgctggtggaagtggcggggatgaaagtgggcctg
atgacctgctacgacgtgcgtttcccggaactggcgcgccgtctggtgctggacggtgct
gatgtgctggtattgcctgccgcgtgggtcaaaggcccgctgaaagagatgcattgggaa
ttgctgtgtacggcaagagcactggaaaacacctgttacatggtggccgtgggcgaatgt
ggcccgcgtaacatcggcaacagtctggtcatcgatcctctcggcgtggcgatagccaaa
gcgccagagtcggcggcactggtgttcgccgatctcgatccacaacgcattgcctacgcc
ccgcagcgtactgccggtgctggaaaaccgccgttttgcacgtcctga

DBGET integrated database retrieval system