KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0820
Entry
APJL_0820         CDS       T00644                                 

Definition
(GenBank) hypothetical protein
  KO
K15257  tRNA (mo5U34)-methyltransferase [EC:2.1.1.-]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Brite
KEGG Orthology (KO) [BR:apj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:apj03016]
    APJL_0820
Enzymes [BR:apj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     APJL_0820
Transfer RNA biogenesis [BR:apj03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    APJL_0820
SSDB
Motif
Pfam: Methyltransf_9 Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_25 Methyltransf_12 CMAS PCMT
Other DBs
NCBI-ProteinID: ABY69380
UniProt: B0BP95
Position
903123..904085
AA seq 320 aa
MIDFRPFYQQIATTNLSAWLETLPLQLKQWEKTTHGDYAKWAKIVDFMPNSTACINLKDK
VESIPHTPLSVGETKQLTHHLKQLMPWRKGPYHLHGIHIDTEWRSDFKWDRVLPHLAPLK
DRTILDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEVVRKLLGNDRRANLIPLGIE
QMQPLAAFDTVFSMGVLYHRKSPLDHLSQLKAQLVKGGELVLETLVIDGDVNTCLVPADR
YAKMKNVYFIPSIDCLINWLEKVGFKNVRCVDQAVTTLEEQRKTDWLENESLVDFLDPND
HSKTIEGYPAPKRAVILANA
NT seq 963 nt   +upstreamnt  +downstreamnt
atgattgactttcgtcctttttatcaacaaatcgcaacaacgaatctgtccgcttggctg
gaaaccttgcctttacaattaaaacagtgggaaaaaactacgcacggtgattatgccaaa
tgggcaaaaattgtcgattttatgccaaattcgaccgcttgtattaatttgaaagataag
gtggaatctattccgcacactccgctttctgttggtgaaaccaaacaacttacgcatcat
ttaaaacagctgatgccttggcgtaaaggaccttatcatttgcacggaattcatattgat
accgaatggcgttccgattttaaatgggatcgtgttctgccacatcttgctccgctgaaa
gaccgtactattttagatgtcggttgtggtagcggttatcatatgtggcgtatggtcggc
gaaggcgcaaaaatggtggtaggaattgacccaaccgaattattcctttgccaatttgaa
gtagtacgcaaattactcggcaatgaccgtcgtgcaaatttaattccgcttggtattgag
caaatgcaaccgttagccgcttttgatacggttttctcaatgggcgtgctttatcaccgt
aaatcgccattagatcatctttcacaacttaaagcgcaactggtgaaaggtggtgaattg
gtattagaaacgctagtgattgatggcgatgtgaatacttgtcttgttccagccgatcgc
tatgcgaagatgaaaaacgtttatttcattccgtcgatcgattgcctgattaactggttg
gaaaaagttggtttcaaaaatgtccgctgtgttgatcaagcagttacaacattagaagaa
cagcgtaaaaccgattggttggaaaatgaaagtttggtcgatttcctcgatccaaatgat
catagtaaaaccattgaaggctatcctgcgccgaaacgtgcagtaattttagccaacgcc
taa

DBGET integrated database retrieval system