KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0865Help
Entry
APJL_0865         CDS       T00644                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00670  One carbon pool by folate
apj01100  Metabolic pathways
apj01120  Microbial metabolism in diverse environments
apj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APJL_0865 (metF)
Enzymes [BR:apj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     APJL_0865 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR DUF4252
Motif
Other DBs
NCBI-ProteinID: ABY69423
UniProt: B0BPD8
Position
957254..958135
Genome map
AA seq 293 aa AA seqDB search
MSYAKEIDHLNHTLADLNGNINASFEFFPAKNEKMEMLLWDSIHRLAPLKPKFVSVTYGA
NSGERKRTHSIVKRIQQDTGLAAAPHLTGIDANPEQLRIIAQDYWENGIRHIVALRGDEP
AGYAKKSFFAKDLVKLLKEVANFDISVAAYPEVHPEAKSAQSDLIYLKQKVEAGANRAIT
QFFFDIDSYLRFRDRCVTVGIDVEIVPGILPVTNFKQLQKMAKITNVKVPHWMHKMYEGL
DDDQTTRNLVAASIAMDMVKILSKEGVKDFHFYTLNRSELTYAICHALGVRPT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcgaaagaaatcgatcacttaaaccatacccttgccgatttaaacggcaat
attaacgcttcttttgaatttttccccgctaaaaacgaaaaaatggaaatgttactttgg
gattcgattcatcgacttgctccgcttaaacctaaattcgtttcagttacctatggtgca
aattccggcgagcgaaaacgtactcattcaattgtgaaacgtattcagcaagataccggt
ttagctgcagcaccgcatttaaccggtattgatgccaatcccgaacagctccgtataatt
gcgcaagattactgggaaaacggtattcgccatattgttgcactacgaggtgacgaacct
gccggttatgctaaaaaatccttttttgcaaaagatttagtaaaactcttaaaagaagtc
gcgaattttgatatttcggttgccgcctatcccgaagtacatccggaggcaaaatcggca
caatccgacttaatttacttaaaacaaaaagtggaagccggtgctaatcgtgcgattacc
caattcttttttgatatcgacagttatcttcgattccgtgatcgctgtgtaaccgttgga
attgatgtggaaatcgtaccgggcattttaccggtcacgaattttaaacaattacaaaaa
atggcaaaaattaccaatgttaaagtaccgcattggatgcataaaatgtatgaaggatta
gatgatgatcagactactcgaaatttggttgccgccagtattgccatggatatggttaaa
attctctcaaaagaaggtgtaaaagatttccatttctacacactgaatcgctccgaatta
acctatgccatttgccacgcattaggcgtacgtccgacctaa

DBGET integrated database retrieval system