KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1394Help
Entry
APJL_1394         CDS       T00644                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00620  Pyruvate metabolism
apj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APJL_1394 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apj02000]
    APJL_1394 (oadA)
Enzymes [BR:apj01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     APJL_1394 (oadA)
Transporters [BR:apj02000]
 Other transporters
  Primary active transporters [TC:3]
   APJL_1394 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Amidohydro_1 ADH_zinc_N GCV_H Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABY69950
UniProt: B0BQW5
Position
1534595..1536397
Genome map
AA seq 600 aa AA seqDB search
MTIQNKKIAITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYWSLEAWGGATFDSCIR
FLGEDPWVRLRELKKAIPNTPLQMLLRGQNLLGYRHYADDVVDRFVERCVKNGMDVFRVF
DALNDPRNMQAALQAVKKHGGHAQGTLSYTTSPVHTLQTWLDVTEQLLEIGVDSLVIKDM
SGILTPIAAYELVGEIKKRYDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTSISSMSGT
YGHPATESIVATLQGTPYDTGLNIPQLEKISAYFRDVRKKYAKFEGQLRGVDSRILVAQV
PGGMLTNLESQLKQQNASDKLDIVLQEIPRVREDLGNIPLVTPTSQIVGTQAVMNVLMGE
RYKTIAKETAGILKGEYGRTPAPVNKALQDRVLEGAAPITDRPANHIAPEIDKLVAEVTA
QAKEKGITLSENAIDDVLIVALFQQVGWKFLENRNNPAAFEPAPTAESAKPAPVAAPKAQ
PQSGPAVYTVELEGKAFVVKVSEGGDITNIAPTAPAAAPQVAAPVTASANAEPVKAPMAG
NILKVEVTEGQQVAEGDMLLILEAMKMETQICAPKAGKVQGVAVKQGDVVAVDQVLMNLA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgactattcaaaataaaaaaattgcaattactgatgttgttttacgtgatgcacaccaa
tctttgtttgcgacacgactacgtttagacgatatgttaccgattgcagctgaattggat
aaaatcggttattggtctttagaggcatggggcggagcaacatttgatagctgtatccgt
tttttaggtgaagatccttgggttcgtttgcgtgaattaaaaaaagcgattccgaatacg
ccgttacaaatgttactacgcggacagaatttattaggctaccgccattatgcggatgat
gtggttgatcgttttgtagaacgttgcgttaaaaacggtatggatgtattccgtgtattt
gatgcgttaaatgaccctcgcaatatgcaagcggcattacaagcggtcaaaaaacacggc
ggtcatgcacaaggtacgttgagctataccaccagtccggtacataccttacaaacttgg
ttagatgtcaccgaacaattattggaaatcggggtagattctctcgttatcaaagatatg
tccggtattttaaccccaatagcggcttatgaattagtcggcgaaattaaaaaacgttat
gacgtagaacttcacttacactgccactccaccaccggtatggcggaaatggcgttatta
aaagcgattgaagcgggtgttgatggcgtagatacttctatttcttcaatgtccggtact
tacggtcatccggcaactgaatctatcgtagcaaccttacaaggcacaccttacgatacc
ggtttaaatattcctcaacttgaaaaaatctccgcttacttccgtgacgttcgtaaaaaa
tatgcgaaatttgaaggtcaattacgtggcgtagatagccgaattttagtcgcacaagtg
ccgggcggtatgctaaccaaccttgaaagccaactaaaacagcaaaatgccagtgataaa
cttgatattgtgttacaagagatcccgcgcgtccgcgaagatctcggtaacatcccgctt
gttacgccaacctcacaaattgtcggtactcaagcggtaatgaacgtattaatgggtgag
cgttataaaactatcgccaaagaaaccgccggtattttaaaaggcgagtacggtcgtaca
cctgcgccggtaaataaagcattacaagatcgtgtacttgaaggtgctgcgccgattacc
gatcgtccggcaaatcatatcgctccggaaattgataaattagtggcggaagtaactgca
caagcaaaagagaaaggtattaccctttccgaaaatgcgattgacgacgtattaatcgtg
gcgttattccaacaagtcggttggaaattcttagaaaaccgcaataatccggcagctttt
gaacctgcaccaacagcagaatccgctaaaccagcgcctgttgcagcaccaaaagcacaa
cctcaatccggtcctgcagtttatacggtagaacttgaaggcaaagcctttgtcgtgaaa
gtgagtgaaggtggcgatattactaatattgcaccaacagcaccagctgccgctcctcaa
gtagcagcacctgtaactgcaagtgccaatgccgaaccggttaaagcgccgatggcgggt
aacattcttaaagtggaagtaaccgaaggtcagcaagtagcggaaggcgatatgttatta
attcttgaagcaatgaaaatggaaacacaaatttgcgcaccaaaagccggtaaagtccaa
ggcgttgcggtaaaacagggtgatgtcgttgccgttgatcaagtcttaatgaatcttgct
taa

DBGET integrated database retrieval system