KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1800Help
Entry
APJL_1800         CDS       T00644                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:apj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    APJL_1800 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:apj03011]
    APJL_1800 (rplV)
Ribosome [BR:apj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    APJL_1800 (rplV)
  Bacteria
    APJL_1800 (rplV)
  Archaea
    APJL_1800 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733 TetR_C_22
Motif
Other DBs
NCBI-ProteinID: ABY70350
UniProt: B0BST6
Position
1961252..1961584
Genome map
AA seq 110 aa AA seqDB search
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADVDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgttacgctcgtacctctgcacaaaaagctcgcttagtt
gctgacctaattcgcggtaaaaaagttgcgcaagcattagaaattttaactttcactaac
aaaaaagcagccgctttagttaagaaagtattagagtcagctattgcaaacgcagagcac
aatgatggtgcagatgtagacgatcttaaagttgctaaaatcttcgtagatgaaggtcca
agcatgaaacgtgttatgccacgtgcgaaaggtcgtgcagatcgtatcttaaaacgtaca
agccacattactgtggttgtgtcagatcgttaa

DBGET integrated database retrieval system