KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1880Help
Entry
APJL_1880         CDS       T00644                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00471  D-Glutamine and D-glutamate metabolism
apj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    APJL_1880 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apj01011]
    APJL_1880 (murI)
Enzymes [BR:apj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     APJL_1880 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:apj01011]
 Precursor biosynthesis
  Racemase
   APJL_1880 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABY70430
UniProt: B0BT16
Position
2025923..2026720
Genome map
AA seq 265 aa AA seqDB search
MKPTILLYDSGMGGLTIYDAIRQTLPNAHYLYCFDNAYFPYSERSENVLIEQAVKIVQKI
AEKYPLDMVVVACNTASTVVLPALREKFAFPIVGTVPAIKPAAAISQTKTIGLLATKGTV
ERPYVAELIEKYAKDCIVEKIGTTTLVELVEEKIRTGQVDQERLIEVIAEWQTHPTLDTV
ILGCTHFPLVKQELQQLLPNVKYFIDPGNGIANRVSALLSESVPEEPEQNKENIAFCTKI
DEEFFKREVIMQQWGFKRLELLNFL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgacaatccttttatatgattcgggaatgggcgggctaaccatttatgatgcg
atacgccaaactttaccgaatgcccattatctctattgtttcgataatgcttactttcct
tattccgagcgttctgaaaacgtcctaatcgaacaagcggtcaaaattgtgcaaaaaatt
gcagaaaaatacccgcttgatatggtcgttgtcgcctgtaatacggcaagtaccgttgta
ttaccggcgttaagagaaaaatttgccttcccgattgtcggaaccgtaccggcaatcaaa
ccggctgcggcaatttcgcaaacgaaaaccatcggattactggcaacaaaagggacggtg
gaacgaccttatgtggcggaacttatcgaaaagtatgcgaaagattgtattgttgaaaag
attgggactactacactagtcgaattggtagaagaaaagatccgaaccggacaggttgat
caagaacgattgatagaagtaatcgctgaatggcaaacgcatccgacacttgatactgta
attttaggttgtactcatttcccgcttgtgaaacaagaattacagcaattattgccgaat
gtgaaatactttattgatccgggtaacggcattgccaatagagtaagtgctttacttagc
gaatctgtaccggaggagccggaacaaaacaaggaaaatatcgccttttgtacgaaaata
gatgaagagttctttaaaagagaagtaattatgcagcaatggggtttcaagcggttagaa
ttgctgaattttttataa

DBGET integrated database retrieval system