KEGG   Acetobacter pasteurianus 386B: APA386B_1852Help
Entry
APA386B_1852      CDS       T02786                                 

Gene name
ltaE
Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
apk  Acetobacter pasteurianus 386B
Pathway
apk00260  Glycine, serine and threonine metabolism
apk01100  Metabolic pathways
apk01110  Biosynthesis of secondary metabolites
apk01120  Microbial metabolism in diverse environments
apk01130  Biosynthesis of antibiotics
apk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA386B_1852 (ltaE)
Enzymes [BR:apk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     APA386B_1852 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCT59921
UniProt: S6DBF6
Position
complement(1943847..1944914)
Genome map
AA seq 355 aa AA seqDB search
MPLPQTTTPPQQFGSDNYAGLCPQALEAISRAAKGSTPAYGDDAWTRLAAKAVADVFETP
DAAVFFVLTGTAANALALATLCPPYCSIIASEVAHAETSERGAPEFFTGGAKLITPPTPD
GKLTPEAIKLAARRASSPRASTPAVVTITQPTENGLVYSVDEIRAIANACHDHGLRLHMD
GARFANAVATLGCTPAAMTWQSGVDALSFGGTKNGMAMGEAVVFFKRSMAQGFAERARQS
GQTASKMRFLSAPWLAMIHSGAWLDNARHANASARQFAQAVEDIPSIKLAWPVQSNAVFL
LMPEPVMNELRARGWRFYTFFGGICRFMFAWDARPEAIAALAADLRSCVRGQGAL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgccgcaaaccaccacgcccccgcaacagtttggcagtgataactatgccggc
ctgtgcccgcaggcgctggaagccataagccgcgcggccaaggggtctacccccgcatat
ggggatgatgcctggacacgccttgccgccaaggctgtggcggatgtgtttgaaacgcct
gatgccgcagtgttttttgtgctcaccggcaccgcagccaatgcgctggcgctggcaaca
ttatgcccaccctattgcagcattattgcctcggaagtggcacatgccgaaacatccgaa
cgcggcgcaccagaattttttaccggcggcgccaaactgataacgccccccaccccagat
ggtaagcttacgccagaagccataaaactggccgcccgccgcgccagcagcccgcgggct
tccacccccgcagtggtaaccattacgcaacccacagaaaacgggcttgtgtattcggtg
gatgagattcgggccattgccaatgcctgccatgatcacggcttgcggctgcacatggat
ggcgcacgctttgccaacgccgttgccacattgggctgcacacctgcggccatgacatgg
caatccggcgtggatgccctaagctttggtggcacgaaaaacggcatggccatgggggaa
gccgtggtgttttttaaacgcagcatggcccagggttttgccgaacgcgccagacagagc
gggcaaacagcctctaaaatgcgttttctctccgccccgtggctagccatgatccacagt
ggcgcatggctggataacgcgcgccacgccaatgccagcgcacgccaatttgcacaggcg
gtagaggatattccctccatcaaactggcatggcccgtgcaatccaacgccgtgtttttg
ctgatgcccgaacctgtaatgaacgaattgcgggcccgtggctggcgcttttacacgttt
tttgggggtatctgccgctttatgtttgcatgggatgcacggccagaagccattgccgct
ctggcagcggatttacgcagctgcgtgcgcgggcaaggtgccttataa

DBGET integrated database retrieval system