KEGG   Acetobacter pasteurianus 386B: APA386B_2446Help
Entry
APA386B_2446      CDS       T02786                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
apk  Acetobacter pasteurianus 386B
Pathway
apk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:apk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    APA386B_2446 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:apk03011]
    APA386B_2446 (rplV)
Ribosome [BR:apk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    APA386B_2446 (rplV)
  Bacteria
    APA386B_2446 (rplV)
  Archaea
    APA386B_2446 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Gag_spuma KORA
Motif
Other DBs
NCBI-ProteinID: CCT60484
UniProt: S6CYZ5
Position
2509985..2510395
Genome map
AA seq 136 aa AA seqDB search
MSKPKHPRTLAETEAQAVTRNIRVSPRKLNLVAGLIRNKPASQAVATLTFSKRRIAQEVK
KTLESAIANAENNHQLDVDQLVVKTAEVGKSIVMRRFHARGRGRSARVEKFFSHLKIVVA
ERAAEPEAASSEQKAA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgaagcatccgcgcacactcgcggaaacagaagcgcaggcagttacgcgc
aacatccgggttagcccccgcaagctgaaccttgtggccggcctgatccgcaacaagcct
gcttcccaggccgttgcaacgttgacgttctctaagcgccgtatcgctcaggaagtgaaa
aagacgctggaaagcgcaatcgctaacgctgaaaacaatcaccagttggacgttgaccaa
ctggtggtgaaaacagctgaagttggaaaatccattgtcatgcggcgtttccatgcccgt
ggccgtgggcgttctgctcgcgttgaaaagtttttcagtcacctgaagattgttgtagct
gaacgggctgctgagcctgaagcagcttcttccgaacagaaggcggcctga

DBGET integrated database retrieval system