KEGG   Acetobacter pasteurianus 386B: APA386B_549Help
Entry
APA386B_549       CDS       T02786                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
apk  Acetobacter pasteurianus 386B
Pathway
apk00480  Glutathione metabolism
apk00590  Arachidonic acid metabolism
apk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    APA386B_549 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APA386B_549 (btuE)
Enzymes [BR:apk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     APA386B_549 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CCT58664
UniProt: S6CWK7
Position
554715..555203
Genome map
AA seq 162 aa AA seqDB search
MNLTCIYDFKLPALNGSTLDLSAYRGKPVLVVNTASKCGFTPQYEGLQALWTQFQKAGLV
VVGVPSNDFGQQEPGTSEEISSFCQINYGVTFPMAARSPVKGPDAIPLFKWLDSELGFLA
RPRWNFFKYLTNRQGMPVAWFSSLTPPTSGRVRHAVEKALKS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgacctgtatatatgattttaaactccccgccctaaatggaagcacccttgat
ctgagcgcttatcgggggaaacctgttctggtggtaaacaccgcatctaaatgcggattt
accccgcaatatgaaggcttgcaggctttgtggacacagttccaaaaagccgggctggtt
gttgtgggggtgccaagcaatgattttggccagcaggaacccggcacttcggaagagatt
tcctccttctgccagatcaattacggggttaccttccctatggcggcacgcagccctgta
aaagggccagatgctattcctctctttaaatggctggatagtgagcttggttttctggct
cggccacggtggaacttctttaagtatctcaccaaccgtcagggtatgccagttgcatgg
tttagcagcctaacgccgcctacatccgggcgtgtcaggcatgctgtggaaaaggctctc
aaatcgtaa

DBGET integrated database retrieval system