KEGG   Acetobacter pasteurianus 386B: APA386B_754Help
Entry
APA386B_754       CDS       T02786                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
apk  Acetobacter pasteurianus 386B
Brite
KEGG Orthology (KO) [BR:apk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    APA386B_754 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CCT58862
UniProt: S6CXU4
Position
771632..772102
Genome map
AA seq 156 aa AA seqDB search
MPDWATSPLLQDPEEAMNELFSSLPVYEAVTENVRVQVQVFWLPDQSEPDEHSYCWAYRI
RIGNDGTEPVQLLERTWHITDTAGHTEYVHGSGVVGELPVIQPGALYEYTSGASLATPGG
FMSGHYLMQDKSSGRRFDASIPAFSLDSPFLLRQIH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactgggccacttctccccttttgcaagatccagaagaagccatgaacgagctc
ttttcctcactgcctgtctatgaggctgttacggagaatgtgcgcgtgcaggtacaggtg
ttctggctgccagaccaatccgaaccagatgagcattcctattgctgggcctatcgtatc
cgcattggtaacgatggcacagagcctgtgcagcttctggaacgcacatggcacatcacg
gatacggccgggcatacagaatatgtgcacggttctggcgtagtgggagaactgccggtt
attcagcccggtgcgctgtatgaatatacttccggggcatcccttgccacgccgggcgga
tttatgagcgggcattatcttatgcaggacaaaagcagcggcagacggtttgatgccagc
atccctgctttcagtctggacagcccttttctgctccgccagatccactaa

DBGET integrated database retrieval system