KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1036
Entry
APL_1036          CDS       T00476                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00620  Pyruvate metabolism
apl00640  Propanoate metabolism
apl00650  Butanoate metabolism
apl01100  Metabolic pathways
apl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APL_1036 (pflB)
   00640 Propanoate metabolism
    APL_1036 (pflB)
   00650 Butanoate metabolism
    APL_1036 (pflB)
Enzymes [BR:apl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     APL_1036 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABN74130
UniProt: A3N144
Position
complement(1202932..1205244)
AA seq 770 aa
MTQLTEAQQKAWAGFTGGDWQTEVNVRDFIQKNYTPYEGDESFLAGATAATTKLWEEVME
KIKVENKTHEPYDIDCDIPSTITSHKAGYIDQALEKIVGLQTDAPLKRAIIPFGGIKMVK
GSCDVYRRTLNPEVEKIFTEYRKTHNQGVFDVYTPDILRCRKSGVITGLPDAYGRGRIIG
DYRRLAVYGADFLMKDKQKQFASLQPRLEAGEDIQATIQLREEIAEQHRALGQIKQMAAS
YGFDVSRPAETAQEAVQWTYFAYLAAVKSQNGAAMSFGRVSSFLDIYIERDLKAGKITEE
EAQELIDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETLAGMGLDGRTLVTKNSFRILNT
LYTMGPSPEPNLTILWSEQLPDGFKRYCAKVSIDTSSVQYENDDLMRPDFDNDDYAIACC
VSPMVVGKQMQFFGARANLAKTMLYAINGGIDEKSGAQVGPKTAPITDEYLNFDDVMARM
DHFMDWLATQYVTALNIIHFMHDKYSYEAALMAFHDRDVFRTMACGIAGLSVAADSLSAI
KYAKVKPVRGDIKDKDGNVVATNVALDFEIEGEYPQFGNNDNRVDEIACDLVERFMKKIQ
THKTYRNATPTQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLT
SVAKLPFAYAKDGISYTFSIVPNALGKDYEAQKRNLAGLMDGYFHHEATVEGGQHLNVNV
LNRETLLDAVEHPEKYPQLTIRVSGYAVRFNSLTKEQQMDVITRTFTESM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgactcaattaactgaagctcaacaaaaagcatgggcagggtttactggtggcgactgg
caaactgaagtaaacgtacgtgattttatccaaaaaaactatactccgtatgaaggcgac
gagtctttcttagctggcgcaaccgctgcgacaactaagttatgggaagaagtgatggaa
aaaattaaagttgagaacaaaactcacgaaccgtacgatattgattgcgacattccatca
acgattacttctcacaaagcgggttatatcgatcaagctttagagaaaatcgtaggtctt
caaactgatgcgccgttaaaacgtgcgattatcccgttcggcggtatcaaaatggttaaa
ggttcttgcgatgtttatcgccgtaccttaaaccctgaagtagaaaaaatctttaccgaa
tatcgtaaaacacacaaccaaggtgtgttcgatgtttatacgccggatattttacgttgc
cgtaaatcaggtgtaattaccggtcttccggatgcttacggtcgtggtcgtattatcggt
gactaccgtcgtttagccgtttacggtgcggacttcttaatgaaagacaagcaaaaacaa
tttgcttcattacaacctcgtttagaagcgggtgaagatatccaagcaacaattcaatta
cgtgaagaaatcgcagaacaacaccgtgcattaggtcaaatcaaacaaatggccgcatca
tacggttttgacgtttctcgtccggcggaaaccgcacaagaagcggttcaatggacttac
ttcgcataccttgctgcggttaaatcacaaaacggtgcggcaatgtcattcggtcgtgta
tcttcattcttagatatctatatcgaacgtgacttaaaagcaggtaaaatcacagaagaa
gaagcacaagagttaatcgaccatttagtaatgaaattacgtatggttcgtttcttacgt
acacctgaatacgatcaattattctcaggcgacccaatgtgggcaaccgagactttagca
ggtatggggttagacggtcgtacattagtaaccaaaaacagcttccgtatcttaaatacc
ctttacacaatgggtccgtcaccggaaccgaacttaactattctttggtctgaacaatta
ccggacggcttcaaacgttattgtgcgaaagtatctatcgatacttcatcagtacaatac
gaaaacgatgacttaatgcgtcctgacttcgataacgatgactatgcaatcgcatgttgc
gtatctccgatggttgtcggtaaacaaatgcaattcttcggtgcacgtgcaaacttagcg
aaaacaatgttatacgcaatcaacggcggtatcgatgaaaaatccggcgcacaagtcggt
ccgaaaacagcaccgattacagacgaatacttaaacttcgacgatgtaatggctcgtatg
gatcacttcatggattggttagcgacacaatatgtgaccgcattaaatatcatccacttc
atgcacgataaatacagctatgaagcagcattaatggcattccacgatcgtgatgtattc
cgtacaatggcgtgcggtatcgcaggtctttccgttgcggctgactcattatctgcaatt
aaatacgcaaaagtgaaacctgttcgtggtgacatcaaagataaagacggtaacgtagtc
gctacaaacgtcgcgttagacttcgaaatcgaaggcgaatatccgcaattcggtaacaat
gacaaccgtgtagatgaaatcgcttgtgacttagttgaacgtttcatgaaaaaaatccaa
acgcacaaaacttaccgcaatgcgacaccaacacagtcagtacttactatcacttctaac
gtggtttacggtaaaaaaactggtaatacgcctgatggtcgtcgtgctggtgcaccgttt
ggcccgggtgcaaacccaatgcacggtcgtgaccaaaaaggtgcggttgcgtcattaact
tctgttgcaaaacttccgtttgcgtatgcgaaagacggtatttcatataccttctcaatc
gtaccaaacgcattaggtaaagattacgaagcacaaaaacgtaaccttgcaggtctaatg
gacggttacttccaccacgaagcaactgttgaaggcggtcagcacttaaacgtaaacgta
ttaaaccgtgaaacattattagatgcggttgagcatccggaaaaatatccgcaattaacc
attcgtgtatccggatatgcggtacgtttcaactctttaactaaagagcaacaaatggac
gtaattactcgtacatttaccgaatcaatgtaa

DBGET integrated database retrieval system