KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0117Help
Entry
APL_0117          CDS       T00476                                 

Gene name
bioB
Definition
(GenBank) biotin synthase
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00780  Biotin metabolism
apl01100  Metabolic pathways
Module
apl_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    APL_0117 (bioB)
Enzymes [BR:apl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     APL_0117 (bioB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BATS Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABN73225
UniProt: A3MYI9
Position
133904..134914
Genome map
AA seq 336 aa AA seqDB search
MTTYNLRLKAKSELTPHPTAQYWRKCQVEELFEMPFMELIFKAAQVHREHFDPQAIQLST
LLSIKTGGCPEECEYCPQSARYDTGLEKQVMMDVEEIVEKAKIAKARGASRFCMGAAWRG
PKPKDIKVVSEIIGAVKALGLETCGTFGLLEDGMAEDLKQAGLDYYNHNLDTDPERYNKI
VHTRNHDDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQL
IKVEGTPLENAEDLDWTEFVRTIAVARITMPKSYVRLSAGRTSMPEAMQTLCFMAGANSI
FYGEKLLTTCNPEEDSDRLLMDKLDLYPLAYEPSDA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctataatttgcgtttaaaagcaaaaagtgaacttaccccccaccctacggca
caatattggcgtaaatgccaagtcgaagaattattcgaaatgccttttatggaacttatt
tttaaagcggcacaagtccatagagagcattttgatccgcaagcgattcaattatcgacg
ttactttcgattaaaaccggaggatgtccggaagaatgcgaatattgtcctcagtccgct
cgctatgataccgggcttgaaaagcaagtgatgatggatgtggaagaaattgtcgagaaa
gccaaaatagccaaagcgagaggcgcgagccgtttttgtatgggcgccgcttggcgtgga
ccgaagccgaaagacattaaagtggtgtctgaaattatcggtgcggtaaaagcgttaggt
ctagagacttgcggtactttcggtttactggaagacgggatggcggaagatttaaaacaa
gccggattagactattacaatcacaatttggataccgatccggaacgctataataaaatc
gtacatacgcgtaatcatgatgatcggatggatacgctcggtaaagtgcgtcatgccggt
ttaaaagtatgctgcggcggaattgtcgggatgaacgaaactcgtccggaacgtgccgga
cttatcgcaagtttagcgaatctcgatccgcaaccggaaagcgtaccgattaaccaatta
attaaagtcgaaggtacgccgttggaaaatgccgaggatctggattggaccgaatttgtc
agaacgattgcggttgcgcgtattactatgccgaaaagctatgtgcgtttatcggcaggt
cgaacctcaatgccggaagcaatgcaaacgttatgttttatggcgggagcgaattcgatt
ttctatggtgagaagttattgacaacttgcaatccggaagaagactccgaccgcttgtta
atggataaattggatttgtatccgctggcgtatgagcctagcgacgcttag

DBGET integrated database retrieval system