KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0384Help
Entry
APL_0384          CDS       T00476                                 

Gene name
ribA
Definition
(GenBank) riboflavin biosynthesis protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00740  Riboflavin metabolism
apl00790  Folate biosynthesis
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    APL_0384 (ribA)
   00790 Folate biosynthesis
    APL_0384 (ribA)
Enzymes [BR:apl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     APL_0384 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     APL_0384 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ABN73488
UniProt: A3MZA2
Position
437672..438877
Genome map
AA seq 401 aa AA seqDB search
MTDFQFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLIC
TPISTEIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVDDNAKA
TDFRRPGHMFPLIAKEGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDL
QKFAVEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVAL
VKGDLTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMTQIEQEGRGVILYLRQEGRG
IGLINKLRAYELQDKGMDTVEANVALGFKEDEREYYIGAQMFQQLGVKSIRLLTNNPAKI
EGLKEQGLNIVAREPIIVEPNKNDIDYLKVKQIKMGHMFNF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttccaattttcaaaagtagaagatgcgatcgaagcgattcgacaaggcaaa
atcattttagtgactgacgatgaagatcgcgaaaacgaaggcgattttatctgtgcggcg
gaatttgccacaccggaaaatatcaattttatggcaacttacggcaaaggtttgatttgt
acgccgatttcaaccgaaatcgctaaaaaattaaatttccatccgatggttgcggtcaat
caagataatcatgaaacggcgtttaccgtatcggtggatcatattgatacgggaacgggt
atctcagcttttgagcgttcgattaccgcaatgaaaattgtcgatgataatgctaaagca
acggatttccgccgcccggggcatatgtttccgttaatcgctaaagaaggtggagtgtta
gtgcgtaacggtcataccgaagcaacagtggatttagctcgtttagccggtttaaaacac
gccggtttatgttgtgaaattatggcggatgacggcacgatgatgactatgccggatcta
caaaaatttgcggtagaacacaatatgccgtttatcacgattcaacaattacaagaatat
cgccgtaagcatgacagcttggtgaaacaaatttctgtggtaaaaatgccgacaaaatac
ggtgagtttatggcacatagctttgttgaagtgatttcaggtaaagaacacgttgcgtta
gtcaaaggcgatttaaccgacggtgagcaagtattggcgcgtatccattcggaatgttta
accggtgacgctttcggttctcaacgttgtgattgcggtcagcaatttgccgcagcaatg
acccaaattgagcaagagggcagaggtgtgattctgtatttacgccaagaaggtcgtggt
atcggtttaatcaataagctacgtgcttacgaactacaagataaagggatggataccgtt
gaagcgaacgtcgctttaggatttaaagaagacgaacgtgagtactatatcggtgcacaa
atgttccagcagttaggcgtaaaatcgatccgtttattaaccaataatccggcaaaaatt
gaaggcttaaaagagcaaggattaaatatcgttgcacgtgagccgattattgtagaaccg
aacaaaaatgacattgattacctaaaagtcaaacagataaaaatggggcatatgtttaac
ttctaa

DBGET integrated database retrieval system