KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0452Help
Entry
APL_0452          CDS       T00476                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00020  Citrate cycle (TCA cycle)
apl00640  Propanoate metabolism
apl00660  C5-Branched dibasic acid metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01130  Biosynthesis of antibiotics
apl01200  Carbon metabolism
Module
apl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APL_0452 (sucC)
   00640 Propanoate metabolism
    APL_0452 (sucC)
   00660 C5-Branched dibasic acid metabolism
    APL_0452 (sucC)
Enzymes [BR:apl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     APL_0452 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABN73556
UniProt: A3MZH0
Position
complement(520241..521407)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQIFAQYRLPVSKGIVCHSLDDAVSAIHTLAGDTWAAKCQVHAGGRGKAGGV
KLVRSEAEIREFCNQWLGQRLVTFQTDKNGQPVNTIYLEETCLIERELYLGAVIDRSSQK
IVFMASNAGGMNIEDVAAQTPELIHKATIDPLTGAQAFQGRELAFKLGLSGDQIKQFAHL
FVQLAKLFIEKDLALLEVNPLVLTKQGQLLCLDAKMVIDSNALYRHPELKALQDPSQEDA
READAAKWDLNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGRPANFLDVGGGATKERVSE
AFKLILSDQNVKAVLVNIFGGIVRCDLIAEGIIAAVNEVGINIPVIVRLEGTNAELGREI
LANSGLRLIAANTLTQAAQLAVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaatatcaagcaaaacaaatttttgcacaatatcgacttcccgtaagt
aaaggtattgtttgtcattctctcgatgacgccgtttcagccattcacacattagcaggc
gacacttgggcggcgaaatgccaagttcacgccggcggtagaggcaaagcgggcggagta
aaattagtgcgcagtgaagcggaaattcgtgagttttgtaatcaatggttgggacagcgt
ttagtcacttttcaaaccgataaaaacggacaaccggtaaatacgatttatctcgaagaa
acgtgcctaatagaacgtgaattatatttgggtgcagtaattgatcgttcttcacaaaaa
attgtttttatggcatcaaatgccggcggtatgaatattgaagatgtcgccgcacaaaca
ccggagcttatccataaagcaaccattgatccgcttaccggtgcgcaagcttttcagggt
cgtgaattagcttttaaactcggtctgtccggcgatcaaatcaaacaattcgctcatctt
tttgtacaacttgccaaattatttattgaaaaagatcttgccttactcgaagtaaatccg
ctcgtattgaccaaacaaggtcaattactttgtttagatgccaaaatggtaattgacagt
aatgctctttatcgccatccggagctaaaagccctacaagatccaagccaagaagatgcg
cgagaagccgatgcggcaaaatgggatcttaactatgtcgcattagacggcaatatcggt
tgtatggttaatggtgcaggcttagccatgggaaccatggatatcgtgaaactacacggt
ggtcgtccggcaaactttttagatgtcggcggcggcgcaacgaaagaacgtgtttcggaa
gcctttaaactgattctttccgatcagaatgttaaagccgtcttagtcaatattttcggc
ggcatcgtcagatgcgatttaattgcggaaggtattattgcggcggttaatgaagtcggg
ataaacattccggtcatcgtgcgtttagaaggtactaatgcggaattaggtcgtgaaatt
ttagcaaacagcggcttacgtctcattgcggcaaatacattaacacaagcggcacaactt
gcagtcaaagcagcggaaggaaaataa

DBGET integrated database retrieval system