KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0651Help
Entry
APL_0651          CDS       T00476                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00040  Pentose and glucuronate interconversions
apl00052  Galactose metabolism
apl00500  Starch and sucrose metabolism
apl00520  Amino sugar and nucleotide sugar metabolism
apl01100  Metabolic pathways
apl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APL_0651 (galU)
   00052 Galactose metabolism
    APL_0651 (galU)
   00500 Starch and sucrose metabolism
    APL_0651 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    APL_0651 (galU)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APL_0651 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABN73751
UniProt: A3N015
Position
complement(744538..745425)
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVHSIVPKDVTLMHVRQGQAKGLGHAVLCGRAVVGN
EPFAVVLPDVILADFTANQKTENLAAMIKRFNETQHSQIMVAPVPREDVSSYGVADCAGV
EIPAGETAKIVKMVEKPSVEEAPSNLAVVGRYVFSAGIWDLLEKTPVGVGDEIQLTDAID
MLIEQETVEAFHMTGRTFDCGDKLGYMQAFTEYSLRHDKFGNDFKEFIKKLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattattccggtagcgggtttagggacgcgaatgcttcctgcaacaaaagcg
attccaaaagaaatgctgacgattgcggataaaccgcttattcaatatatcgtgaacgaa
tgtgtagcggctggtattaaagagatcgtattagtgactcattcttcaaaaaatgctatc
gagaaccattttgatacgtcttttgaacttgaaactatgttggaaaaacgtgttaaacgc
caattattagaagaagtgcactcaattgtgccaaaagacgttacattaatgcatgtacgt
caaggtcaagctaaaggtttaggtcatgcggtattatgcggtagagcggtagtcggtaac
gaaccttttgcagtcgtattaccggatgtaattttagccgattttactgcgaatcaaaaa
acggaaaaccttgcggcgatgatcaaacgtttcaacgaaacacaacatagccaaattatg
gttgcaccggtaccgagagaagatgtaagtagctatggcgtagcggattgtgcaggcgtg
gaaattcctgccggcgaaactgcaaaaatcgtgaagatggttgaaaaaccgagtgtagaa
gaagcaccttctaatttagcggttgtcggtcgttacgtattctccgcaggtatttgggat
ttattagagaaaacaccggttggtgtaggcgatgagatccaattaaccgatgctattgat
atgttaattgagcaagaaacggtagaagcatttcatatgacaggtcgtactttcgactgc
ggcgataaattaggttatatgcaggcatttaccgaatatagtttacgtcatgataagttc
ggcaatgactttaaagaatttattaaaaaattagctaaaacgttataa

DBGET integrated database retrieval system