KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0755Help
Entry
APL_0755          CDS       T00476                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00061  Fatty acid biosynthesis
apl00780  Biotin metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01130  Biosynthesis of antibiotics
apl01212  Fatty acid metabolism
Module
apl_M00083  Fatty acid biosynthesis, elongation
apl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    APL_0755 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    APL_0755 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    APL_0755 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:apl01004]
    APL_0755 (fabI)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     APL_0755 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     APL_0755 (fabI)
Lipid biosynthesis proteins [BR:apl01004]
 Fatty acid synthase
  Component type
   APL_0755 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short TSA
Motif
Other DBs
NCBI-ProteinID: ABN73853
UniProt: A3N0B7
Position
865141..865929
Genome map
AA seq 262 aa AA seqDB search
MSFLTGKRILVTGLASNRSIAYGIAKAMKAQGAELAFTYLNDKLQPRVEEFAKEFGSDIV
LPLDVATDESIQNCFAELSKKWEKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAARPYLNENAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKD
GIRVNAISAGPIRTLAASGIKNFKKMLSAFEKTAALRRTVTIDDVGNSAAFLCSDLASGV
TGEVLHVDAGFSITAMGELGEE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagctttttaacaggtaaacgcattttagtaacgggtcttgcaagcaaccgttctatc
gcatacggcattgcaaaagcaatgaaagcacaaggcgcagaactcgcattcacttattta
aacgataaattacaaccgcgtgttgaagaatttgctaaagaattcggttcggacatcgta
ttaccattagatgtagcgacagacgaatcaatccaaaactgctttgcagaattaagcaaa
aaatgggaaaaattcgacggtttcgtacacgccatcgcattcgcaccgggcgatcaatta
gacggtgattatgtaaacgcggcaacacgcgaaggctaccgtatcgcacacgacatcagc
gcatacagcttcgttgcaatggctcaagcggctcgtccgtacttaaacgaaaatgcggca
cttttaaccttaagctacttaggtgcggaacgtgcgattcctaactacaacgtaatgtgt
ttagcaaaagcgtcattagaagcggcgacgcgtgtaatggcggcggatttaggtaaagac
ggtattcgtgtaaatgcaatctctgcaggtccaatccgtacacttgcggcatcaggcatc
aaaaacttcaaaaaaatgctttctgcattcgagaaaaccgcagcattacgtcgtaccgtt
accattgacgatgtaggtaactcggcggcattcttatgttcggacttagcttcaggtgta
accggtgaagtattacacgttgatgcaggtttcagcattactgcaatgggtgaattaggc
gaagaataa

DBGET integrated database retrieval system