KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0773Help
Entry
APL_0773          CDS       T00476                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00010  Glycolysis / Gluconeogenesis
apl00020  Citrate cycle (TCA cycle)
apl00620  Pyruvate metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01130  Biosynthesis of antibiotics
apl01200  Carbon metabolism
Module
apl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_0773 (aceE)
   00020 Citrate cycle (TCA cycle)
    APL_0773 (aceE)
   00620 Pyruvate metabolism
    APL_0773 (aceE)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     APL_0773 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABN73871
UniProt: A3N0D5
Position
complement(887432..890086)
Genome map
AA seq 884 aa AA seqDB search
MSEIERDVDPFETKEWLESLDSLIRVEGVERAQYIIDQLLDQARTEGVPVQSGVTTAYVN
TIPVSAQPAYPGDHKIERRIRSAVRWNAIAMVLRSQKKDLDLGGHISTFQSAATMYEVCY
NHFFKAATEKNGGDLVFFQGHAAPGMYARAYVEGRLTEEQLDNFRQEAFTDGLSSYPHPK
LMPEFWQFSTVSMGLGPVNAIYQARFLKYLENRGLKDTADQKVYAFLGDGEMDEIESKGA
LTFAAREKLDNLIFTVSCNLQRLDGPVNGNGKIIQELEGLFTGAGWEVIKVLWGGNWDKL
FAKDTSGKLAQLMMEVVDGDYLTFKSKDGAYIREHFFGRYPETAALVADMTDDEIWDLRR
GAHDSEKLYAAYAKAQKSDKPVVILAHQVKGYKIPEAESKNTAHQSKKMSLESLKGFRDY
FELPLTDEQVESLEYIKFAEGSEEYNYIHGHRKALNGYVPARRAKFDVEYKVPALDEFKA
LLAEQPRGISTTMAFTRALNILLKDKNIGKTIVPMIVDEARTFGMEGLFRQVGIYNPHGQ
NYTPSDRDLVAYYREAKDGQVLQEGINELGGAASWVAAATSYSVSNQPMIPFFIYYSMFG
FQRVGDMMWLAGDQLARGFMVGGTSGRTTLNGEGLQHEDGHSHIQAGIIPNCVTYDPSFA
FEVAVIMQDGINRMYGEKQENVFYYMTTLNEVMEQPAMPEGAEEGIRKGLYKFETVKGKG
KGNVQLLGSGSIMRHVREAAQILANDYGVTSDVFSAPSFNELAREGNDAVRWNLLHPTAE
QRIPYVAQVLADLPTVASTDYVKQYADQIRAFVPSKHYHVLGTDGFGRSDSRANLREHFE
VDARYVVVAALSQLAKEGTVETKVVADAIAKFGLNVDRINPLYA
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagatcgaaagagacgtagatccattcgaaaccaaagaatggttagagtcatta
gattctttaatccgtgtagaaggtgttgagcgcgctcaatatattattgaccaattatta
gatcaagctcgtacggaaggcgtacctgttcaatcaggcgttacaactgcatatgtgaat
actatccctgtaagcgcacaacctgcatatcccggcgatcataaaattgaacgtcgtatc
cgttctgcagtacgttggaatgctattgcaatggttttacgtagccagaagaaagatctc
gacttaggtggtcatatttctactttccaatcagcggcaacgatgtatgaagtgtgctat
aaccacttcttcaaagcggcgactgaaaaaaacggcggtgacttagtatttttccaaggt
cacgccgcgccgggtatgtatgctcgtgcttatgttgaaggtcgtttaacggaagagcaa
ttagataacttccgtcaagaagcgtttaccgacggtttatcttcatatcctcacccgaaa
ttaatgcccgaattttggcaattctcaaccgtatcaatgggtttaggtcccgttaatgcg
atttaccaagcgcgtttcttaaaatatcttgaaaaccgcggtttaaaagataccgctgat
caaaaagtatatgcgttcttaggcgacggcgagatggatgaaatcgagtctaaaggtgca
ttaactttcgcagcgcgtgaaaaattagataacttaattttcacagtaagctgtaactta
caacgtttagacggtccggtaaacggtaacggtaaaatcattcaagaattagaaggttta
tttactggtgcgggctgggaagtaattaaagtattatggggcggtaactgggataaatta
ttcgcaaaagatacctctggtaaattagcgcaattaatgatggaagtggttgatggcgac
tacttaaccttcaaatcgaaagacggtgcttatatccgtgaacacttcttcggtcgttac
cctgaaacagccgcattagttgcggatatgaccgatgatgagatttgggatcttcgccgt
ggtgcgcacgacagtgaaaaactttatgccgcatatgcgaaagcacaaaaatcagacaaa
ccggttgtgattttagcgcaccaagttaaaggttataaaattcctgaagcggaaagtaaa
aataccgctcaccaatcgaaaaaaatgtcattagaaagcttaaaaggcttccgtgactac
ttcgaattaccattgacggatgaacaagtagaaagcttagagtacatcaagtttgccgaa
ggttctgaagaatacaactacattcacggtcaccgtaaagcattaaacggttatgtgccg
gctcgtcgtgccaaattcgacgtagagtataaagtccctgcattagatgaatttaaagca
ttacttgcagaacaaccacgtggtatttcaaccacaatggcgtttacacgtgcattaaat
atcttattaaaagataaaaatatcggtaaaaccatcgttccgatgatcgtggacgaagcg
cgtacattcggtatggaaggtttattccgtcaagtgggtatttacaacccgcacggtcaa
aactataccccttcagaccgtgatttagtggcttactaccgtgaagcgaaagacggtcaa
gtattacaagaaggtatcaacgaattaggtggtgcggcatcttgggtggctgcggcgact
tcttactccgtaagtaaccaaccgatgatcccgttcttcatctattactcaatgttcggt
ttccaacgtgtgggcgatatgatgtggttggcaggtgaccaattagcgcgcggtttcatg
gtcggcggtacttcaggtcgtacaacgttaaacggtgaaggcttacaacacgaagacggt
cacagccatatccaagcgggtattattcctaactgtgtaacttatgatccatcatttgcg
tttgaagtagcggtaattatgcaagacggtattaaccgtatgtatggtgaaaaacaagaa
aatgttttctactatatgacaacattaaacgaagtaatggagcagcctgcaatgcctgaa
ggtgcagaagagggtatccgtaaaggtttatataaatttgaaacggttaaaggtaaaggt
aaaggtaacgttcagttattaggctcaggttctattatgcgtcacgttcgtgaagcagca
cagatccttgcgaatgactacggcgtaacttcagatgtattctcagctccgtcatttaac
gagctagctcgtgaaggtaacgatgcagtacgttggaacttattacacccgacagcagaa
caacgcattccttatgtagcgcaagtattagcggacttaccgacagtcgcttcaaccgac
tatgtaaaacaatatgcggatcaaattcgtgcattcgtaccaagcaaacactatcacgtg
ttaggtacggacggtttcggtcgttcggacagccgtgcgaacttacgtgagcatttcgaa
gtagatgcgcgttatgttgttgttgcagcattatcacaattagcgaaagaaggcacggta
gaaacgaaagttgttgctgatgcaatcgctaaattcggcttaaacgtagatcgtattaac
ccgttatacgcataa

DBGET integrated database retrieval system