KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0859Help
Entry
APL_0859          CDS       T00476                                 

Gene name
trpCF
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01130  Biosynthesis of antibiotics
apl01230  Biosynthesis of amino acids
Module
apl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APL_0859 (trpCF)
Enzymes [BR:apl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     APL_0859 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     APL_0859 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ABN73955
UniProt: A3N0L9
Position
complement(1000124..1001533)
Genome map
AA seq 469 aa AA seqDB search
MQNQPTILQKIVQDKAVWVDNKQKTFPLSQFQQQIVTADRDFYAALAAVSHQVPAYILEC
KKASPSKGLIRAEFDLDAIAQVYKHYASVISVLTDEQYFQGDFRYIEQVKRQTMQPILCK
DFMISPYQVYLARYSNADAILLMLSVLDDETYRTLADLAHSLGMGVLTETSTEQEFERAL
ALGAKVIGVNNRDLHTLTVDMNRIVRLVEKYQEQIPADVRLISESGIYDHTQVKAIKPFA
HAFLIGSSLMGSADLNNAVRSVIFGENKVCGLTRPQDVKAVYENGFLYGGLIFAENSPRQ
LSLRQAQELVVNAPLRYVGVFQNQAVEFVEKIAKQLELYAVQLHGTEDEAYITKLSEKLA
GKTQIWQAISVDVQAETVEYHDNPLVARYILDSKHGAQQGGTGRVFDWQIISSELKPKAL
LAGGISAENIEQALVQGCLGVDLNSGVEQHKGVKDLAKMTACAEKILKA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccaacctactattctgcaaaaaatcgtacaagataaggccgtttgggtcgat
aacaaacaaaaaacctttccactttcgcaattccaacagcaaattgttaccgctgatcgg
gatttttatgccgcactggctgcggtttcacatcaagtaccggcttatattttggaatgt
aaaaaagcctcgccatccaaaggcttgattcgtgccgaatttgatttagatgcgattgcg
caggtctataaacattacgcttccgtgatttccgtactgaccgacgaacaatatttccaa
ggcgattttcgttatatcgagcaagttaaacgccaaacaatgcaaccaatcttatgcaaa
gattttatgatttctccgtatcaggtgtatttggctcgttattcaaatgcggatgcgatc
ttgttaatgctctcggtattagatgacgaaacgtatcgcacattggcggatttagctcac
tcattaggtatgggcgttttaaccgaaaccagtaccgagcaagaatttgagcgagcgtta
gcattaggtgcaaaagtgattggcgtgaataaccgtgatttacatacgctgacggtggat
atgaatcgcattgtacgtttggtagaaaaatatcaggagcaaattccggcagatgtccgt
ttgatttcagaatcaggcatttatgatcatacgcaagtgaaagcgattaagccgtttgcg
cacgcatttttaatcggcagcagcttaatgggcagtgccgacttaaataatgcggtacgt
tcggtgatcttcggtgaaaataaagtgtgcggattaactcgcccacaagatgtcaaggca
gtgtatgaaaacggctttttatacgggggattaatttttgccgaaaattcgcctcgccaa
ttatcactacgccaagcacaagaattagtcgtgaatgcaccattgcgttatgtcggtgtg
ttccaaaatcaagcggttgaatttgtcgaaaaaatagcaaaacagcttgagttatatgcg
gtgcagttgcacggtacggaagatgaagcctatattaccaaattgtctgaaaaattagcc
ggaaaaacgcaaatctggcaggcaatttcggtggatgttcaggcggaaacggttgagtat
cacgataatccgttagtggctcgttatattctggatagcaaacacggtgcgcaacagggc
ggtacgggtagggtgtttgactggcagatcatttcaagcgaattaaaaccaaaagcactg
cttgccggtgggatttcggctgaaaatatcgaacaggctctagtacagggctgtttaggc
gttgatcttaattccggtgtagagcagcataaaggcgtaaaagatttagcaaaaatgacc
gcttgtgcggagaaaattctcaaagcctaa

DBGET integrated database retrieval system