KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1311Help
Entry
APL_1311          CDS       T00476                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00030  Pentose phosphate pathway
apl00480  Glutathione metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01200  Carbon metabolism
Module
apl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
apl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APL_1311 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APL_1311 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apl04147]
    APL_1311 (zwf)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     APL_1311 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     APL_1311 (zwf)
Exosome [BR:apl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   APL_1311 (zwf)
  Exosomal proteins of colorectal cancer cells
   APL_1311 (zwf)
  Exosomal proteins of bladder cancer cells
   APL_1311 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABN74395
UniProt: A3N1V9
Position
complement(1502152..1503639)
Genome map
AA seq 495 aa AA seqDB search
MNIENSCIVIFGASGDLTFRKLIPALYNLFRVGRLGQHFSVLGVARSELTDDSFRTKMRD
ALVKFEKAQGQELEDFCTHLYYQAVNTSDALDYAKLLPRLDELHDKYGSCGNTLYYLSTP
PSLYGVIPECLAAHGLTTEEYGWKRIIVEKPFGYDIKTAKELDEKIHHYFEEHQIYRIDH
YLGKETVQNLLVLRFSNGLFEPLWNRNFIDYVEITGAEAIGVEERGGYYDGSGAMRDMFQ
NHLLQVLAMVAMEPPAIINADSMRDEVAKVLHCLHPLTAEDVKNNVVLGQYVAGEVDDQM
VAGYLAEKGVPADSNTETYMAIKCEIDNWRWAGVPFYVRTGKRLPTRVTEVVIHFKTTPH
PVFSQNAPENKLIIRVQPDEGISMRFGLKKPGAGFEAKEVSMDFRYSDLSSASSLLTAYE
RLLLDALKGDATLFARTDAVHACWKFVQPILDYKAERGRVYEYEAGTWGPTEADKLIAKH
GKVWRKPSGVMKKKV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaaaatagttgtattgttatttttggtgcatcgggcgatttaacttttcgt
aagttaattccggcactttataacttgtttagagttggtcgcttagggcagcatttctcg
gtattgggcgtagcgcgttccgaattaacggacgattctttccgtaccaaaatgcgtgat
gcgttagttaaatttgagaaagcgcaaggacaggagttagaagacttctgtacccatttg
tattatcaagcggtaaatacgtccgatgccttggactatgccaaattattacctcgctta
gacgaattgcacgacaaatacggcagttgcggtaatacgctttattatctttctacgccg
ccgagtttatacggcgtgattccggaatgtttagccgcacacggtttaaccaccgaagaa
tacggctggaaacgtatcatcgtcgaaaaaccgttcggttacgatattaaaaccgctaaa
gaattagacgagaaaattcatcattactttgaagaacatcaaatctaccgtatcgaccat
tatttaggtaaggaaacggttcaaaatttacttgtacttcgtttctcaaacggtttattc
gagcctttatggaaccgcaactttatcgattacgtagaaattaccggtgcggaagcgatc
ggcgtagaggaacgcggcggttattatgacggttcgggtgcaatgcgtgatatgttccag
aaccatttattacaagtgttggcgatggtggcgatggaaccaccggcaattattaatgcc
gattcaatgcgtgacgaagtggcgaaagtgctgcattgcttacatccgcttactgccgaa
gatgtaaaaaataatgtggtactcggacaatatgtagcgggtgaagtggatgatcagatg
gttgccggttacttagcagaaaaaggcgtaccggcggattcgaataccgaaacctatatg
gcgattaagtgtgagattgataactggcgttgggcgggggtgccgttttatgtgcgtacc
ggtaaacgtttgccgactcgtgtaaccgaagtggtgattcattttaaaaccacgccgcat
ccggtattcagccaaaatgcgccggaaaataaattaattatccgagtgcaaccggacgag
gggatttcaatgcgtttcggcttgaaaaaaccgggtgcaggctttgaggcgaaagaagtt
tccatggacttccgttattccgatttaagttcggcttccagcctattaaccgcttatgag
cgtttattattagatgcgttaaaaggcgatgcgactttattcgcgcgtaccgatgcggta
cacgcttgttggaaattcgttcagccgattttagattataaagcggaaagaggcagagtt
tatgaatacgaagccggcacttgggggccgaccgaagcggataaacttatcgccaaacac
ggtaaagtttggcgtaaaccgtcaggcgtgatgaagaaaaaagtataa

DBGET integrated database retrieval system