KEGG   Anas platyrhynchos (mallard): 101789554
Entry
101789554         CDS       T02816                                 

Gene name
ARNTL2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 2 isoform X2
  KO
K09099  aryl hydrocarbon receptor nuclear translocator-like protein 2
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101789554 (ARNTL2)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101789554 (ARNTL2)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2 Pam17 ATPase
Other DBs
NCBI-GeneID: 101789554
NCBI-ProteinID: XP_005026349
Ensembl: ENSAPLG00000008758
Position
1
AA seq 639 aa
MLGFNGMKPFTEKENIRRSLSCTNKRKWFRKQAGHLCAKEYLDNFSIDGSPCITSGVSSL
MNPITKTVTASFNASVAEIPRKRKGSDSDNQVAVEVDGDPQKRSEDEEHLKIKDFREAHS
QTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHLKSLKGSTSSYTEVRYK
PSFLKDDELRQLILRAADGFLFVVGCNRGKILFVSESVCKILNYDQASLIGQSLFDYLHP
KDVAKVKEQLSSSDVSPREKLVDGKTGLQVHTDFQAGPARLNSGARRSFFCRIKCSRTTV
KEEKECLPNPKKKDHRKYCTIHCTGYMKNWPPSEVGVEEENDVEKDSSNFNCLVAIGRLH
PYIVPQKSGEIKVKATEFVTRFAMDGKFVYVDQCATAILGYLPQELLGTSCYEYCHQDDH
NHLAEKHKEVLQNKEKVFTNSYKFRAKDGTFVTLKSQWFSFMNPWTKELEYIVSNNTVVL
GHNESAEEQVPYASQPTEDAVKQSLVSVPGMSSGTVLGAGSIGTEIANEILELQRLDSSP
SGELSPSHLLRRSPSPALTVNCSNVPDKELTQLCPSEVEVLQTSEQNQGAIPFPSNEPLL
SWSSHRAMLNTVLSFGQKSMCYEVEDLPLPTLSEDLPPV
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgcttggttttaatggtatgaaaccattcacagaaaaggaaaatataaggaggtccctc
agctgcacaaacaaaaggaagtggtttaggaagcaggctggccatctgtgtgcaaaggag
tatttagataatttctcaatagatggaagcccgtgcattacttctggagtctcaagcctc
atgaatccaataactaagactgttactgcttctttcaacgcttctgtggctgagattcca
aggaagcgcaaaggaagtgattctgataaccaggttgcggttgaagttgatggtgatcct
cagaaaaggagtgaagatgaagaacatcttaagataaaagatttcagagaggctcacagt
caaacagagaaacgaagaagagacaaaatgaataatttgatagaggaattgtctgctatg
ataccccagtgcaaccccatggcacgaaaactagataaacttacagttttacggatggct
gtgcaacacttaaaatctttaaaaggttccactagctcttataccgaagttcgatataaa
ccttcatttttaaaggatgatgagctcagacaattaatccttagggcagcagatggattc
ctgtttgtggttggatgtaacagaggaaaaattctgtttgtctcagaatcagtttgcaaa
atacttaattatgatcaggccagtttaattggacaaagtttgtttgattacttgcatcca
aaagatgttgccaaagtgaaggagcaactttcatcttcagatgtctctcccagagaaaag
cttgtagatggcaaaactggcttgcaagtacacacagattttcaagctggaccagctcga
ctgaattctggtgctcgacgttccttcttctgtcggataaaatgtagtaggaccacagtc
aaagaagagaaggagtgcttgcccaacccaaagaagaaagatcacaggaaatactgtacc
attcactgtactgggtacatgaagaactggcctcctagcgaggtgggagtggaagaggaa
aatgatgtggaaaaggacagtagtaactttaactgtcttgttgcaattgggaggttacac
ccttacattgttccacaaaagagtggagagataaaagtcaaagcaacagaatttgttaca
cgatttgccatggatggaaaatttgtttacgtagatcagtgtgcaacagcaattttaggg
tatctgccacaagagcttctaggaacttcttgttacgagtactgccatcaagatgatcac
aatcatctagctgaaaaacataaagaagtgttgcagaataaagaaaaagtatttacaaat
tcctacaaatttagagcaaaagatgggacatttgttactttaaagagtcagtggtttagt
ttcatgaatccgtggaccaaagaactggagtacattgtatcaaacaacactgtagtatta
ggtcacaatgagtctgctgaagaacaggtaccctatgcttcccagcctacagaagatgct
gttaaacaatctttagtgagtgtacctggaatgtcctctggaacggttcttggtgctggc
agtataggaaccgaaattgcaaatgaaatattagaattgcaaaggttggattcttcacca
tctggggagttaagtccatcacatctcttgagaaggtcaccttctccagctttaactgta
aactgcagcaatgtgccagataaggagttgactcagttatgtccttcagaagtagaagtt
ctacagacttcagaacaaaatcagggtgctattccatttccgagtaatgaacctctcctc
agttggtcatcacacagagcaatgcttaatacagtcctctcttttggtcaaaaatcgatg
tgctatgaagtggaggacttgccactgcccaccttgtcagaggatctccctcctgtgtag

DBGET integrated database retrieval system