KEGG   Anas platyrhynchos (mallard): 101789614Help
Entry
101789614         CDS       T02816                                 

Gene name
PPIL2
Definition
(RefSeq) RING-type E3 ubiquitin-protein ligase PPIL2 isoform X1
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101789614 (PPIL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:apla03041]
    101789614 (PPIL2)
   03110 Chaperones and folding catalysts [BR:apla03110]
    101789614 (PPIL2)
   04121 Ubiquitin system [BR:apla04121]
    101789614 (PPIL2)
Enzymes [BR:apla01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101789614 (PPIL2)
Spliceosome [BR:apla03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    101789614 (PPIL2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    101789614 (PPIL2)
Chaperones and folding catalysts [BR:apla03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101789614 (PPIL2)
Ubiquitin system [BR:apla04121]
 Ubiquitin ligases (E3)
  U-box type E3
   101789614 (PPIL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Rtf2 zf-NOSIP U-box
Motif
Other DBs
NCBI-GeneID: 101789614
NCBI-ProteinID: XP_027325428
Ensembl: ENSAPLG00000005026
Position
16
AA seq 521 aa AA seqDB search
MGKRQHQKDKMYITCAEYTQFYGGKKADHPRTNFRRISFDHCSLSLQPFEYPVCTPDGTV
FDILSIVPWIKKYGTNPITGEKLDAKSLIKLNFAKNSEGKYHCPVLFTVFTNNSHIVAIK
TTGNVFAYEAVEQLNIKPKSYKDLLTDEPFTRQDIVTLQDPTNLDKFNVSNFFHVKNNIK
IIDPDEEKAKLDPSYYLKNTNAETRETLLELYKEFKGDDILAATMKAPEKKKVDKLNAAH
YSTGAVSASFTSTAMVPETTHEAAAIDEDVVRYKYVKKKGYVRLHTNKGDLNLELHCDMT
PRTCENFIKLCKKNYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFKPNLSH
TGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTVFGRVVGGFETLTAMENVESDPKTD
RPKEEIRIQSTTVFVDPYEEADAQVAAEREKAQQEEEAAKTKAEVIPPKKEVQTPKTYRQ
GIGKYINMAAAKRSVEDDGPSTSTAAKKEKKSTGFGDFSSW
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcggcagcaccagaaggacaagatgtacatcacctgcgccgagtacacgcag
ttctacggcggcaagaaggcagaccatccacgaactaatttcagacgtatatcatttgat
cactgcagtttgtctctgcagccatttgaatatccagtttgcacaccagatgggacagtc
tttgacatactgagcattgttccttggataaagaaatatggaaccaaccctatcacagga
gaaaaactagatgccaaatcacttataaagttgaattttgctaaaaacagtgaaggtaaa
taccactgtcccgtgctgtttactgtattcaccaataactcccatattgtggccatcaag
acaactgggaatgtgtttgcctatgaggcagttgagcagctgaacataaaaccaaagagc
tacaaagatctcttgactgatgagcccttcactcggcaagacattgtgacactgcaggat
ccaacaaacttggataaattcaatgtctctaacttctttcatgttaagaacaacataaaa
ataattgatccagatgaagaaaaagcaaaattagatccatcttactatttgaaaaataca
aatgctgagacacgagagactttattggagctctataaggagttcaaaggtgatgatatt
ctagcagctactatgaaggctcctgaaaagaagaaagtggataagctgaatgcagctcac
tattccactggagcagtaagtgcttccttcacctccactgcaatggtgcctgaaactacc
catgaagcagctgctattgatgaagatgttgtaagatacaaatatgtgaagaagaagggc
tatgtacgactccacactaataaaggagacttaaacttggagctacactgtgacatgaca
ccccgaacgtgtgaaaactttatcaaactgtgcaagaagaactattatgatggaacaatt
ttccacagatcaattcgtaattttgtcatccaaggaggtgatccgactggaacaggaaca
ggtggagagtcttactggggaaaaccttttaaagatgaattcaagcccaacttgtcccat
acaggacgtggtgttcttagtatggccaattcaggacctaacacaaacaaatcacagttc
tttatcacattccgctcttgtgcatatctggacaagaagcatacagtgtttggaagagtg
gtcggtggttttgagactctgactgctatggagaatgtggaaagtgacccaaaaacagac
cgccccaaggaagaaatccgaattcagtcaacgaccgtttttgttgatccgtatgaagag
gcggatgcccaggttgctgcagagagagagaaggctcagcaagaagaagaagcagccaaa
acaaaagctgaggtgatcccaccaaagaaagaggtccagactcctaaaacttaccgtcag
gggattggaaaatacattaacatggctgcagcgaagcgcagtgtggaagatgacgggccc
tcaacaagcacagctgcgaagaaagagaaaaagagcacaggcttcggggacttcagctcc
tggtag

DBGET integrated database retrieval system