KEGG   Anas platyrhynchos (mallard): 101790027Help
Entry
101790027         CDS       T02816                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00562  Inositol phosphate metabolism
apla01100  Metabolic pathways
apla04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101790027 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101790027 (PIK3C2G)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     101790027 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX PI3K_C2 C2 DUF4135 PI3K_rbd
Motif
Other DBs
NCBI-GeneID: 101790027
NCBI-ProteinID: XP_027310961
Ensembl: ENSAPLG00000009943
Position
1
AA seq 1475 aa AA seqDB search
MAYFGRVPFLYDEYHEGHTGDQAPYPVYHSDSNGDIHLGFDQIADEVSNEFFFYGSSHSH
HHEEHFFTSDNFGLNVPEKHFCGQPPVAYDEVHPANPVSHWQQGTVSPAIGFKSSLLSDD
RNFSLVDSYPYSQEREIFRGNHVTTVPNAFDSNVEIGNTYFQIGFDDVDAQRPVFLDNYP
FAQVREESRNGEGYLINSSNRYSIGPTWPSSSGHDREVTGWSIQLVEANQGSNENTVAFC
NAVEEIRNAYPAYDLKTNTGKIWSVTTKFPDHILGESRFRISIWTDSSPYPLLLTKHAGC
ITHNLIAEILCCTNQYPVQEECLLSVCGSDEFLQNNCTLGSHESLRKSTTCIQLRLHVTT
NLKQSLARTYEDDQRQFSVNQLLEYTCAWRLTRLNLVSVIMKYRDQVEHLLQNEQHKVDN
VIEVAKAICSILCFVETRDITDAVKKLLAVPLVKAQLLLLQCAQRALMEAAVTELSMAIS
RLIHVYSSSFETDFQLASIPKNPSCADISLDSQLSFTIYAAHNIPEVWVNSYKVFSFSCS
LTYAGKTICQVKICKRIPVKRSFFFLAEWNEKINFPLRIKALPRETILIIKLLGVNSASK
NTEVLAWTCSPLYPKERLIHGTVLLSMKLDSILPASMITPGICSTDIPTSVTLQIDFPET
NLEFIKPEPEEKKDLEEPTKECLKHIARLSQAQSLLLLSEQQRRILWFYRYYCNNQNCSL
PLVLGSAPSWDRTTVSEMYSVMRRWRFSNPLEAFGLLTFSFPDKDIRRTAVQQIENLSND
ELLEYLPQLVQVLKFEWSLESPLVKLLLHRSLQSTQIAHQLYWLLKNAQNEIHFKIWYRK
LLAAFQFSAGKALNNEFSKEGKLLRILEDIAEKVKAASDQKRKEVLKMELSRLQQFFQEV
KVCRLPLNPALVVQGIEADSCSYFTSNAFPLKISFINANAPSGNINIIFKIGDDLRQDML
VLQIIRLMDNIWLQEGLDMQMIIYKCLSTGKDQGLVQMVPDATTLAKIHRKSGLIGPLKE
NTIKKWFRHHHQLESSYQEAIRNFFYSCAGWCVVTFILGICDRHNDNIMLTNAGHMFHID
FGKFLGHAQTFGSIRRDRASFIFTSEMEYFITEGGKNPQRFQEFVELCCRAYNIVRKHSQ
LLLNLLEMMLHAGLPELKSIQDLKYVYDNLRPQDSDLQATSYFTRKIKESLECFPVKLNN
LIHTLAQMSVTGSAKPPAPETVPQEWMMLNTEKSIARATILGFNKKSDSLYLVQVVQTCN
VVTFVEKSFDQFSKLHSQLQKQFPSEALPEFPHSWHIPFADLEHKRVKDLNLYLKQLLSG
SIKMANNELVLSFFLNWTKKTFTETSSSVTLGPQSTDHKPGVQLVISYEGTRLTIMLKHM
RNIRLPDGSAPSAHAEFYLLPDPDEVSRRKTRTVPKSTDPTYNEIVVYNKVMELKSHILK
LVVKSKGTFVGAVNIQLSSVQLNEEKWYPLGNSVI
NT seq 4428 nt NT seq  +upstreamnt  +downstreamnt
atggcatattttggaagggttcctttcttatatgatgaatatcatgaaggacacactggg
gaccaagcaccttatccagtgtaccattctgattctaatggagacatccacctaggattt
gatcaaatagctgatgaagtcagcaatgaattttttttttatggttcatcacattcacat
catcatgaagaacattttttcacatcagacaactttggtctgaatgtgccagagaagcat
ttctgtggtcagcctccagttgcttatgacgaagttcaccctgcaaatccagtatctcat
tggcaacaaggcacagtgtcaccagcgattggtttcaagtcttctttactgtctgatgac
agaaacttctctctggtggattcctacccttacagtcaagagagagaaatcttcagaggg
aatcatgtaactacagtcccaaatgcgtttgattcaaatgtggagataggcaacacatat
tttcagataggttttgacgatgtagatgctcaacgtcctgttttcttagacaactaccca
tttgcacaagtgagagaagaaagcagaaatggggagggttatttaatcaacagttccaat
agatacagcataggacctacttggcccagcagctctggacatgacagagaggttacaggt
tggtctatccagctggttgaagcaaatcaagggagtaatgaaaacacggttgctttttgc
aatgcagtggaggaaatcagaaatgcctatcctgcttatgacttgaagacaaacactggg
aaaatctggagtgttacaacaaagttcccagaccatattcttggtgaatcaagatttaga
atcagcatttggacagattcttcaccatatcctctgcttcttacaaaacatgctggctgt
attactcacaacttaattgcggagatcctctgttgcacaaatcaatacccagtccaagaa
gaatgtcttctaagtgtttgtgggtctgatgaattcttacaaaataattgtactttgggc
agccatgagagtcttcgcaagtcaaccacctgcattcagcttcggctacacgtcaccaca
aatttgaaacaaagtttggctcgaacgtacgaggatgaccaaagacagttcagtgtgaat
cagctgttagaatatacttgtgcttggagactgactcgactgaaccttgtctcagttatt
atgaaatatagagatcaagtggagcatctattgcaaaatgagcagcataaagttgataat
gtgattgaagttgctaaagcaatctgcagtatcctctgctttgtggaaaccagagacatt
actgatgcagtcaagaaactccttgcggtgccattggtgaaagcacagctgctcttgttg
caatgtgcccagagagcattaatggaggctgctgtgactgagctctccatggccatctct
cgtctcatccatgtttacagcagcagctttgaaacagatttccagcttgccagcatacct
aaaaacccttcatgtgcagacatcagtcttgattcccagctcagctttacgatttatgct
gcccataacataccagaagtgtgggtgaacagttacaaagttttttctttttcctgttca
ctgacctacgctgggaagacaatatgtcaagtgaagatttgcaaacgtataccagttaaa
agatccttctttttcctggcagagtggaatgagaaaatcaactttcctctgcgaataaag
gctcttccaagggaaactatactgataataaaactactcggagtgaacagtgcttctaaa
aacacagaggtgcttgcttggacatgctccccattgtatccaaaagagcggctcatccat
ggaactgtgcttcttagcatgaagttggacagcatacttccagcatcaatgattacccca
ggcatctgcagtactgatataccaacttcagtaacgttgcagattgactttccagaaact
aatttggagttcattaaacctgaacctgaagagaaaaaagatcttgaagagccaaccaag
gagtgcctgaagcatattgcaagactttcacaggcacagtctctcttgctactctcagag
caacagagaagaatcttatggttttatcgttactactgcaataatcaaaattgctccctt
cctctggtactgggcagtgcacccagttgggatcgaacaactgtatcagaaatgtattct
gtcatgaggagatggagattttctaaccctctagaggcattcgggctcctgactttcagt
tttccagataaagatattcgcagaacagcagtccaacaaatagaaaatctgtcaaatgat
gaattgctagaatacctcccacagctggttcaggtgcttaagtttgaatggagtcttgaa
agccctctagtaaaactcctgttgcatcgctctcttcaaagcacacaaatagcccatcaa
ctttactggctgttgaagaatgcacagaatgaaattcatttcaaaatctggtatcggaaa
ctactggctgctttccaattctctgctggaaaagccctgaacaatgagttttctaaggag
gggaaacttcttagaattttggaagacatcgctgaaaaagtaaaagctgccagtgaccaa
aaaagaaaggaggtgttaaagatggaactcagcagacttcagcagttcttccaggaggta
aaggtttgtcgacttcccctgaatcctgcacttgttgtgcaaggcatagaagcagattca
tgctcatattttacatccaatgcttttccattaaaaatttccttcatcaatgcaaatgct
ccaagtggaaacatcaatattatttttaagataggcgatgatctacgtcaagatatgctg
gttctgcaaattattcgactgatggacaacatttggctccaagagggactggatatgcaa
atgataatttataagtgtttgtccacaggaaaagaccaaggattggtacagatggtgcca
gatgctaccacactagccaaaatccacaggaaatctggactaataggaccattgaaagaa
aacacaattaaaaaatggttccgtcatcaccatcagctggagtcaagttaccaagaggca
ataaggaatttcttttattcctgtgcgggctggtgtgttgtcaccttcattctgggcatc
tgtgaccgacacaatgacaacataatgctgacaaatgctggacacatgttccacatagat
tttggaaaatttttaggtcatgcacagacatttggaagtataagaagggaccgagcttct
ttcatcttcacatcagagatggagtatttcatcacagaaggtggaaaaaacccacagcgt
tttcaagagtttgtggagctttgttgtcgagcatataatatagtcaggaaacacagccag
ttactcttgaatctgctggagatgatgctgcatgcaggattgcctgaactgaagagcatt
caggatttgaaatatgtctatgataacctccgtcctcaggactcagacctccaggctaca
agctactttacaaggaaaataaaggaaagtttggagtgctttcccgttaagctcaataac
ttgatccacacacttgcacagatgtcagtgacaggctctgcaaagcctccagctccagag
actgtcccccaggaatggatgatgctgaacacagagaagtcaattgcaagagccaccatt
ttggggttcaacaaaaagtctgactccctatatctagtccaggtggtacaaacctgcaat
gtggtcacttttgtggagaaatcgtttgaccagttctcaaaacttcacagccagctccag
aagcagtttccatcagaggcactcccagagtttccccactcatggcatataccttttgca
gatcttgaacataaaagagtgaaggatttgaatctctatctgaagcagctattaagtgga
tccatcaagatggcaaataatgagcttgtactcagcttcttcttgaattggaccaaaaaa
accttcacagaaacatcatcatctgtgaccttaggtcctcagtcaactgatcataagcct
ggagtacaattagtcatatcttatgagggcacccgtctgacaataatgctgaaacacatg
aggaatattcgcctcccagatggttctgccccaagtgcacatgctgaattttatcttctg
ccggaccctgatgaggtcagtcgaaggaaaacaagaacggttccaaaaagcactgaccct
acttacaatgaaattgttgtgtacaacaaagtcatggagctcaaaagccatatactgaag
cttgttgtgaaaagcaaaggaacatttgtgggagctgttaacattcaactgagtagtgtc
cagttaaatgaagaaaaatggtatccactgggaaacagtgtaatttaa

DBGET integrated database retrieval system