KEGG   Anas platyrhynchos (mallard): 101790639Help
Entry
101790639         CDS       T02816                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X13
  KO
K09052  cAMP response element modulator
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:apla00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101790639 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101790639 (CREM)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101790639 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23
Motif
Other DBs
NCBI-GeneID: 101790639
NCBI-ProteinID: XP_005011417
Ensembl: ENSAPLG00000013843
Position
2
AA seq 143 aa AA seqDB search
MSVLLLVILHMLASLEQFMLSSGRGTGEACVQKLVMAVTGDETAATGDMPAYQLRTPTTT
LPQGVVMAASPGTLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVL
ENQNKTLIEELKALKDLYCHKAE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgctcttgcttgtaatcctgcacatgcttgctagtttggaacagttcatgctg
agctctggtagagggacaggagaagcctgtgtgcagaagctggtcatggctgtaacagga
gatgaaacagctgccactggagacatgccagcttaccagcttcgaactcccactactacc
ttacctcagggagtggtaatggcagcctcgccagggactctgcatagccctcagcagttg
gcagaggaggcaacacgcaagagagagctgcgacttatgaaaaatagggaagctgccaga
gaatgtcgcagaaagaagaaagaatatgtcaaatgtcttgaaaatcgtgtggctgtgctt
gaaaaccaaaacaagactctcattgaggaactcaaggccctcaaagatctttattgtcat
aaagcagaataa

DBGET integrated database retrieval system